ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd2m03 |
|---|---|
| Clone Library Name | barley_pub |
>APLP2_MOUSE (Q06335) Amyloid-like protein 2 precursor (CDEI box-binding| protein) (CDEBP) Length = 695 Score = 36.2 bits (82), Expect = 0.067 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -2 Query: 388 MNKNKDEESGPSVPKIADRDREGDLFPV-ASLDEYAEQAVQKDESDEEDARDFVKD 224 M+K ++EE + D D + FP A L+++ E A ++E DEE+ + V+D Sbjct: 215 MSKEEEEEEEDEEDEEEDYDLDKSEFPTEADLEDFTEAAADEEEEDEEEGEEVVED 270
>APLP2_HUMAN (Q06481) Amyloid-like protein 2 precursor (Amyloid protein homolog)| (APPH) (CDEI box-binding protein) (CDEBP) Length = 763 Score = 33.9 bits (76), Expect = 0.33 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 382 KNKDEESGPSVPKIADRDREGDLFPV-ASLDEYAEQAVQKDESDEEDARDFVKD 224 + +DEE + D D FP A L+++ E AV +D+ DEE+ + V+D Sbjct: 217 EEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVED 270
>FAK1_CHICK (Q00944) Focal adhesion kinase 1 (EC 2.7.10.2) (FADK 1) (pp125FAK)| Length = 1053 Score = 30.4 bits (67), Expect = 3.7 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -2 Query: 382 KNKDEESGPSVPKIADRDREG---DLFPVASLDEYAEQAVQKDESDEEDARDF 233 + + E + PS+PK+A+ +++G V+ D+YAE ++D RD+ Sbjct: 363 QKEGERALPSIPKLANNEKQGVRSHTVSVSETDDYAEIIDEEDTYTMPSTRDY 415
>FAK1_RAT (O35346) Focal adhesion kinase 1 (EC 2.7.10.2) (FADK 1) (pp125FAK)| Length = 1055 Score = 30.4 bits (67), Expect = 3.7 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -2 Query: 382 KNKDEESGPSVPKIADRDREG---DLFPVASLDEYAEQAVQKDESDEEDARDF 233 + + E + PS+PK+A+ +++G V+ D+YAE ++D RD+ Sbjct: 363 QKEGERALPSIPKLANNEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDY 415
>RED2_HUMAN (Q9NS39) Double-stranded RNA-specific editase B2 (EC 3.5.-.-)| (dsRNA adenosine deaminase B2) (RNA-dependent adenosine deaminase 3) (RNA-editing deaminase 2) (RNA-editing enzyme 2) Length = 739 Score = 30.4 bits (67), Expect = 3.7 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +1 Query: 196 FYSTRPCKLNLSQNPWHLLHQTHPSVQPVQ----HIRQEMQQGKGRLPDLGPRSLE 351 + ST PC +P+ + H S V+ H+R +++ G+G +P GP +++ Sbjct: 484 YVSTSPCGDARLHSPYEITTDLHSSKHLVRKFRGHLRTKIESGEGTVPVRGPSAVQ 539
>MALT_PHOLL (Q7N976) HTH-type transcriptional regulator malT (ATP-dependent| transcriptional activator malT) Length = 904 Score = 30.0 bits (66), Expect = 4.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 83 ASSLVKISLINRNIYLCQNKYWHFSSELESSA 178 A L IS +NRN+ LC YWH + E+ + Sbjct: 721 ARELQLISDLNRNLLLCNLLYWHIGRKSEAQS 752
>FAK1_HUMAN (Q05397) Focal adhesion kinase 1 (EC 2.7.10.2) (FADK 1) (pp125FAK)| (Protein-tyrosine kinase 2) Length = 1052 Score = 30.0 bits (66), Expect = 4.8 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = -2 Query: 382 KNKDEESGPSVPKIADRDREG---DLFPVASLDEYAEQAVQKDESDEEDARDF 233 + + E + PS+PK+A+ +++G V+ D+YAE ++D RD+ Sbjct: 363 QKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDY 415
>CRCB1_STRR6 (Q8DPG7) Protein crcB homolog 1| Length = 109 Score = 29.6 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 368 LILIFVHKANQCPSLPLPSISDGLL*CFALTVFFLSIPSNKL 493 L+ F + NQ LPL ++ LL CF + VF+ + S ++ Sbjct: 15 LVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEV 56
>CRCB1_STRPN (Q97QC5) Protein crcB homolog 1| Length = 109 Score = 29.6 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 368 LILIFVHKANQCPSLPLPSISDGLL*CFALTVFFLSIPSNKL 493 L+ F + NQ LPL ++ LL CF + VF+ + S ++ Sbjct: 15 LVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEV 56
>SRP1_SCHPO (Q10193) Pre-mRNA-splicing factor srp1| Length = 275 Score = 29.3 bits (64), Expect = 8.2 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +1 Query: 229 SQNPWHLLHQTHPSVQPVQHIRQEMQQGKGRLPDLGPRSLELMARSPHPYFCS*GESVSF 408 S++P++ S+ P R G+ R PD RS + RSP P VSF Sbjct: 125 SRSPYNDERSDRRSMSPRYRSRSRSPDGRSRSPDYDRRSPKRNHRSPSP--------VSF 176 Query: 409 AP 414 AP Sbjct: 177 AP 178
>COX2_PONPP (P92721) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 29.3 bits (64), Expect = 8.2 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = +2 Query: 200 TVPDLANLIF---HKIPGIFFIRLILLYSLFSIFVKRCNREKVAFPISVRDLWN*WPALL 370 T P + L+ H + IF I ++LY+LF + ++ + +W PA++ Sbjct: 13 TSPIMEELVIFHDHALMIIFLICFLILYALFLTLTTKLTNTNISDAQEMETIWTILPAII 72 Query: 371 ILIFVHKANQCPSLPLPSISD 433 +++ PSL + ++D Sbjct: 73 LILIA-----LPSLRILYLTD 88
>COX2_MANLE (P98037) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 227 Score = 29.3 bits (64), Expect = 8.2 Identities = 15/68 (22%), Positives = 32/68 (47%) Frame = +2 Query: 230 HKIPGIFFIRLILLYSLFSIFVKRCNREKVAFPISVRDLWN*WPALLILIFVHKANQCPS 409 H + + I L++LY+LFS + + + +W PA+++++ PS Sbjct: 26 HALMAMSLISLLVLYALFSTLTTKMTNTNITDAQEMETIWTILPAIILVLIAF-----PS 80 Query: 410 LPLPSISD 433 L + ++D Sbjct: 81 LRILYMTD 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,102,056 Number of Sequences: 219361 Number of extensions: 1490525 Number of successful extensions: 4233 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4225 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
