Clone Name | rbasd2k24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU1M_DALCH (O63623) NADH-ubiquinone oxidoreductase chain 1 (EC 1... | 28 | 9.6 |
---|
>NU1M_DALCH (O63623) NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (NADH| dehydrogenase subunit 1) Length = 310 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 155 LCVNSCFIGFGKDIFPLGHFXMLYFXSVFGAWKKET 48 +C+ SC I FG D L + L F F W + T Sbjct: 234 ICLVSCIIFFGSDFNSLFFYIKLIFLCFFFIWVRST 269 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,566,714 Number of Sequences: 219361 Number of extensions: 524403 Number of successful extensions: 872 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)