Clone Name | rbasd2j12 |
---|---|
Clone Library Name | barley_pub |
>ILP_BRACL (P22334) Insulin-like peptide precursor [Contains: Insulin-like| peptide B chain; Insulin-like peptide A chain] Length = 305 Score = 31.2 bits (69), Expect = 2.3 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 303 RRRSVVDDSATHAATIHVGTSIRNPYTTGPKSSTNMYTSPPKPAFAPE 446 RRR +V++ + S NPY+T P ++T + T+ P+P A + Sbjct: 78 RRRGLVEECCYNVCDYSQLESYCNPYSTAPATATPVRTTEPQPEEAED 125
>CAC2D_RABIT (P13806) Dihydropyridine-sensitive L-type, calcium channel| alpha-2/delta subunits precursor [Contains: L-type calcium channel alpha-2 subunit; L-type calcium channel delta subunit] Length = 1106 Score = 30.0 bits (66), Expect = 5.0 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 472 NSHGDKAHSSGAKAGLGGDVYILVEDLGPVVYGFRIEVPTWM 347 N G A+ SG ++YI + L P V G +I+V +W+ Sbjct: 784 NKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWI 825
>CAC2D_HUMAN (P54289) Dihydropyridine-sensitive L-type, calcium channel| alpha-2/delta subunits precursor [Contains: L-type calcium channel alpha-2 subunit; L-type calcium channel delta subunit] Length = 1091 Score = 30.0 bits (66), Expect = 5.0 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 472 NSHGDKAHSSGAKAGLGGDVYILVEDLGPVVYGFRIEVPTWM 347 N G A+ SG ++YI + L P V G +I+V +W+ Sbjct: 769 NKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWI 810
>TCEA3_MOUSE (P23881) Transcription elongation factor A protein 3 (Transcription| elongation factor S-II protein 3) (Transcription elongation factor TFIIS.h) Length = 347 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 306 RRSVVDDSATHAATIHVGTSIRNPYTTGPKSSTNMYTSPPKPAFAPELCALSPC 467 RR VD ++ ++ + R+ + + +SP P FAP +C L+PC Sbjct: 126 RRDSVDSRSSTTSSPKRPSLERSNSSKSKVETPTTPSSPSTPTFAPAVCLLAPC 179
>CAC2D_MOUSE (O08532) Dihydropyridine-sensitive L-type, calcium channel| alpha-2/delta subunits precursor [Contains: L-type calcium channel alpha-2 subunit; L-type calcium channel delta subunit] Length = 1103 Score = 29.3 bits (64), Expect = 8.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 472 NSHGDKAHSSGAKAGLGGDVYILVEDLGPVVYGFRIEVPTWM 347 N G A+ SG ++YI + L P V G +I+V +W+ Sbjct: 781 NKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWI 822
>CAC2D_RAT (P54290) Dihydropyridine-sensitive L-type, calcium channel| alpha-2/delta subunits precursor [Contains: L-type calcium channel alpha-2 subunit; L-type calcium channel delta subunit] Length = 1091 Score = 29.3 bits (64), Expect = 8.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 472 NSHGDKAHSSGAKAGLGGDVYILVEDLGPVVYGFRIEVPTWM 347 N G A+ SG ++YI + L P V G +I+V +W+ Sbjct: 769 NKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWI 810 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,248,072 Number of Sequences: 219361 Number of extensions: 1704498 Number of successful extensions: 4050 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4048 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)