| Clone Name | rbasd2j08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DEGP_BUCAI (P57322) Probable serine protease do-like precursor (... | 30 | 3.3 | 2 | NEF_HV2G1 (P18038) Nef protein (Negative factor) (F-protein) (3'... | 29 | 7.3 |
|---|
>DEGP_BUCAI (P57322) Probable serine protease do-like precursor (EC 3.4.21.-)| Length = 478 Score = 30.4 bits (67), Expect = 3.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 403 PFFPGEVPGIYSETCFFNPSGQYKLPERRXLGSGLMGSPVKG 528 PF G P +S C NP K + R LGSG++ + KG Sbjct: 85 PFCQGNSPFRHSPFCHINPDSDDKKEKFRALGSGVIINADKG 126
>NEF_HV2G1 (P18038) Nef protein (Negative factor) (F-protein) (3'ORF)| Length = 254 Score = 29.3 bits (64), Expect = 7.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 416 PGKKGRVCFTWLWFVIPPDIMKHS 345 PG + +CF WLW ++P D+ + + Sbjct: 161 PGVRYPMCFGWLWKLVPVDVSQEA 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,922,508 Number of Sequences: 219361 Number of extensions: 1526079 Number of successful extensions: 2993 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2993 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)