| Clone Name | rbasd2i11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AER_ECOLI (P50466) Aerotaxis receptor | 32 | 2.1 | 2 | RRN5_YEAST (Q02983) RNA polymerase I-specific transcription init... | 30 | 6.2 | 3 | MED7_YEAST (Q08278) RNA polymerase II mediator complex subunit 7... | 30 | 6.2 | 4 | ATG26_YARLI (Q6C8M8) Sterol 3-beta-glucosyltransferase (EC 2.4.1... | 30 | 8.1 | 5 | SYV_STAS1 (Q49Y96) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 30 | 8.1 |
|---|
>AER_ECOLI (P50466) Aerotaxis receptor| Length = 506 Score = 31.6 bits (70), Expect = 2.1 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = -3 Query: 495 ELMDQFGNVWHHTRVRKYLTADDWSPIEAKGRPWYGLLGLLRKYPEHFVINTKS 334 EL Q N+ H + K AD W ++ KG PW G++ RK +H+ + + Sbjct: 47 ELQGQPHNMVRHPDMPKAAFADMWFTLK-KGEPWSGIVKNRRKNGDHYWVRANA 99
>RRN5_YEAST (Q02983) RNA polymerase I-specific transcription initiation factor| RRN5 Length = 363 Score = 30.0 bits (66), Expect = 6.2 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +2 Query: 389 PYHGLPLASMGDQS---SAVRYFRTLVWCHTLPNWSISSV 499 P H LPL+ Q+ RY RTL+WC L + SV Sbjct: 188 PRHALPLSRSATQTLERCVSRYTRTLLWCTALAGMASRSV 227
>MED7_YEAST (Q08278) RNA polymerase II mediator complex subunit 7 (RNA| polymerase II transcriptional regulation mediator 7) Length = 222 Score = 30.0 bits (66), Expect = 6.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 604 PSHSSNGRERSRVICCDCVI*PLWPRRMDAYENTPYRAYGPVWQ 473 P++S+ G E D +I P P+ N YRA+G +WQ Sbjct: 47 PNNSNGGSEEEITCALDYLIPPPMPK------NQQYRAFGSIWQ 84
>ATG26_YARLI (Q6C8M8) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1424 Score = 29.6 bits (65), Expect = 8.1 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 163 SGHHSTFQTRTNRPTDG-SRMRNKTQARL*RQPRLAGP*SSLGEQGNQRDELRD 321 SGHH F + +DG S ++ T +R PR P GEQ ++RDE RD Sbjct: 422 SGHHHHFFHSAHHESDGKSNSKSHTSSRS-HTPRNLTP-QVTGEQPHERDEKRD 473
>SYV_STAS1 (Q49Y96) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 876 Score = 29.6 bits (65), Expect = 8.1 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 449 RTLVWCHTLPNWSISSVWSVFIGIHSPGPQRSDNTVATDDT--TSFSS 586 R L W H +P W +F+G H P+ +N V +D T FSS Sbjct: 405 RQLWWGHQIPAWYHKETGEIFVGEHE--PEDIENWVQDEDVLDTWFSS 450 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,494,691 Number of Sequences: 219361 Number of extensions: 1847654 Number of successful extensions: 5320 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5320 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)