Clone Name | rbasd2h18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor... | 29 | 6.3 |
---|
>ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor (ICAM-2)| (CD102 antigen) Length = 275 Score = 29.3 bits (64), Expect = 6.3 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = -2 Query: 235 STTCLTGS-GKRSEFLSVLLVSQEAAWKRYCP---SYDAIFVCK*YCQRKTEFISSSL 74 STTC G L+ +L+ ++A WK Y S+D + C C K E ++S++ Sbjct: 49 STTCNQPEVGGLETSLNKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNV 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,907,565 Number of Sequences: 219361 Number of extensions: 1246479 Number of successful extensions: 2950 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2950 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)