| Clone Name | rbasd2h07 |
|---|---|
| Clone Library Name | barley_pub |
>SUI12_ARATH (Q94JV4) Protein translation factor SUI1 homolog 2| Length = 113 Score = 37.4 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 +TFLVQAGL KK++IKIHGF Sbjct: 94 STFLVQAGLVKKDNIKIHGF 113
>SUI11_ARATH (P41568) Protein translation factor SUI1 homolog 1| Length = 113 Score = 37.4 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 +TFLVQAGL KK++IKIHGF Sbjct: 94 STFLVQAGLVKKDNIKIHGF 113
>SUI1_SALBA (O48650) Protein translation factor SUI1 homolog| Length = 113 Score = 36.2 bits (82), Expect = 0.021 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 ++FLVQAG+ KKE+IKIHGF Sbjct: 94 SSFLVQAGIVKKENIKIHGF 113
>SUI1_BRAOL (Q9SQF4) Protein translation factor SUI1 homolog (Translation| initiation factor nps45) Length = 113 Score = 35.4 bits (80), Expect = 0.037 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 +TFLVQAGL KK+ I+IHGF Sbjct: 94 STFLVQAGLVKKDDIQIHGF 113
>SUI1_SPOST (Q9SM41) Protein translation factor SUI1 homolog| Length = 115 Score = 35.0 bits (79), Expect = 0.048 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 + FLVQAG+ KKE IKIHGF Sbjct: 96 SNFLVQAGIVKKEHIKIHGF 115
>SUI1_ORYSA (P33278) Protein translation factor SUI1 homolog (GOS2 protein)| Length = 115 Score = 35.0 bits (79), Expect = 0.048 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 + FLVQAG+ KKE IKIHGF Sbjct: 96 SNFLVQAGIVKKEHIKIHGF 115
>SUI1_MAIZE (P56330) Protein translation factor SUI1 homolog (GOS2 protein)| Length = 115 Score = 35.0 bits (79), Expect = 0.048 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 + FLVQAG+ KKE IKIHGF Sbjct: 96 SNFLVQAGIVKKEHIKIHGF 115
>SUI1_PIMBR (O82569) Protein translation factor SUI1 homolog| Length = 113 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -2 Query: 310 ATFLVQAGLAKKESIKIHGF 251 +TF+VQAG+ KK+ IK+H F Sbjct: 94 STFIVQAGIVKKDQIKVHNF 113
>MDLA_BUCBP (Q89A97) Multidrug resistance-like ATP-binding protein mdlA (EC| 3.6.3.44) Length = 579 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 11 FNXLDKXTAYWWRIQTMVKNNLHQH 85 FN +++ +A W RI++M+ NNL H Sbjct: 298 FNIIERGSASWDRIKSMINNNLFIH 322
>EIF1_CHICK (P51971) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) (Fragment) Length = 79 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 304 FLVQAGLAKKESIKIHGF 251 FLV+ GLAK + +K+HGF Sbjct: 62 FLVEIGLAKDDQLKVHGF 79
>EIF1_PONPY (Q5RFF4) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) Length = 113 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 304 FLVQAGLAKKESIKIHGF 251 FLV+ GLAK + +K+HGF Sbjct: 96 FLVEIGLAKDDQLKVHGF 113
>EIF1_HUMAN (P41567) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) (Sui1iso1) (A121) Length = 113 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 304 FLVQAGLAKKESIKIHGF 251 FLV+ GLAK + +K+HGF Sbjct: 96 FLVEIGLAKDDQLKVHGF 113
>EIF1_BOVIN (Q5E938) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) Length = 113 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 304 FLVQAGLAKKESIKIHGF 251 FLV+ GLAK + +K+HGF Sbjct: 96 FLVEIGLAKDDQLKVHGF 113
>EIF1_MOUSE (P48024) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) Length = 113 Score = 29.3 bits (64), Expect = 2.6 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 304 FLVQAGLAKKESIKIHGF 251 FL++ GLAK + +K+HGF Sbjct: 96 FLIEIGLAKDDQLKVHGF 113
>POLG_PVYN (P18247) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral gen Length = 3063 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYHU (Q02963) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3061 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAVESTFYPPTKKHL 597
>POLG_PVYO (P22602) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3] (Fragment) Length = 856 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYC (P22601) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3] (Fragment) Length = 856 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>SUI1_ANOGA (P42678) Protein translation factor SUI1 homolog| Length = 110 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 304 FLVQAGLAKKESIKIHGF 251 +L ++GLAK E +K+HGF Sbjct: 93 WLTKSGLAKPEQLKVHGF 110
>VE1_HPV37 (Q80902) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 609 Score = 27.7 bits (60), Expect = 7.6 Identities = 20/71 (28%), Positives = 29/71 (40%), Gaps = 4/71 (5%) Frame = +2 Query: 41 WWRIQTMVKNNLHQHTDAKFKCLDVKEHQTQT----PHTTTSNANVFRCEDTKYLYDNFQ 208 W I ++N L D F CLD+K P TSN ++ + E +YL+ Sbjct: 489 WDYIDQYLRNGL----DGNFVCLDLKHRAPCQIKFPPLLLTSNMDIMKEERYRYLHSRVH 544 Query: 209 ASVSDNTRAFE 241 A N F+ Sbjct: 545 AFAFPNKFPFD 555
>SVF1_KLULA (Q6CQY2) Survival factor 1| Length = 403 Score = 27.3 bits (59), Expect = 10.0 Identities = 23/83 (27%), Positives = 31/83 (37%) Frame = +2 Query: 8 SFNXLDKXTAYWWRIQTMVKNNLHQHTDAKFKCLDVKEHQTQTPHTTTSNANVFRCEDTK 187 +F D T Y Q + N + HT A+F + T T+ FR E T Sbjct: 60 TFYFTDLETGYTGFAQVIHSNIIGLHTTAQFTFRIYHKENTDDQIWTSVKLENFRIEGTN 119 Query: 188 YLYDNFQASVSDNTRAFECCLKS 256 + DN S+ N E KS Sbjct: 120 FYADNL--SIVMNEEGTEVQFKS 140
>ACHA7_CHICK (P22770) Neuronal acetylcholine receptor protein, alpha-7 subunit| precursor Length = 502 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = -2 Query: 169 EDIC----IASSRVRRLCLMLFYIQTFEFGIGVLM 77 E IC A+S V RLCLM F + T IG+LM Sbjct: 454 EAICNEWKFAASVVDRLCLMAFSVFTIICTIGILM 488
>VIT_ICHUN (Q91062) Vitellogenin precursor (VTG) [Contains: Lipovitellin LV-1N;| Lipovitellin LV-1C; Lipovitellin LV-2] Length = 1823 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 225 LSDTEAWKLSYKYLVSSHLKTFALL 151 LSD WKL K+ +S+H+K A + Sbjct: 1399 LSDLSVWKLCAKFRLSAHMKAKAAI 1423
>POLS_EEEV (P08768) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike gl Length = 1239 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +2 Query: 101 KCLDVKEHQTQTPHTTTSNANVFRCEDTK----YLYDN 202 KC DV+E T + HTTT C D K YL DN Sbjct: 522 KCPDVREGITSSDHTTT-------CTDVKQCRAYLIDN 552
>MIA_MOUSE (Q61865) Melanoma-derived growth regulatory protein precursor| (Melanoma inhibitory activity) (Cartilage-derived retinoic acid-sensitive protein) (CD-RAP) Length = 130 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -1 Query: 110 PDI*IWHRCVDASCSSPWSVCATSRQXVYPGC 15 P + W C D CS P S+ + V P C Sbjct: 27 PKLADWKLCADEECSHPISMAVALQDYVAPDC 58
>LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM)| Length = 1799 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 31 HCLLVAHTDHGEEQLASTHRCQIQMSGC--KRASNTDASH---DY*QCKCL 168 HC HG+ S HRC + G +R +TD H QC CL Sbjct: 1019 HCGYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCL 1069 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,227,940 Number of Sequences: 219361 Number of extensions: 785424 Number of successful extensions: 2174 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 2144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2173 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)