Clone Name | rbasd2g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RK22_WHEAT (Q95H48) Chloroplast 50S ribosomal protein L22 | 77 | 1e-14 | 2 | RK22_ORYSA (P12140) Chloroplast 50S ribosomal protein L22 | 72 | 4e-13 | 3 | RK22_ORYNI (Q6END4) Chloroplast 50S ribosomal protein L22 | 72 | 4e-13 | 4 | RK22_SACOF (Q6ENS4) Chloroplast 50S ribosomal protein L22 | 66 | 2e-11 | 5 | RK22_SACHY (Q6L3F9) Chloroplast 50S ribosomal protein L22 | 66 | 2e-11 | 6 | RK22_MAIZE (P06589) Chloroplast 50S ribosomal protein L22 | 66 | 2e-11 |
---|
>RK22_WHEAT (Q95H48) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 77.4 bits (189), Expect = 1e-14 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = -1 Query: 134 KYIPRIXXXKSGLRKLAXKVPTDRLLKFERVFKAQKRIPMSVFK 3 KYIPRI KSGLRKLA KVPTDRLLKFERVFKAQKRIPMSVFK Sbjct: 8 KYIPRIKKKKSGLRKLARKVPTDRLLKFERVFKAQKRIPMSVFK 51
>RK22_ORYSA (P12140) Chloroplast 50S ribosomal protein L22| Length = 149 Score = 72.0 bits (175), Expect = 4e-13 Identities = 38/44 (86%), Positives = 38/44 (86%) Frame = -1 Query: 134 KYIPRIXXXKSGLRKLAXKVPTDRLLKFERVFKAQKRIPMSVFK 3 KY PRI KSGLRKLA KVPTDRLLKFERVFKAQKRI MSVFK Sbjct: 8 KYTPRIKKKKSGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFK 51
>RK22_ORYNI (Q6END4) Chloroplast 50S ribosomal protein L22| Length = 149 Score = 72.0 bits (175), Expect = 4e-13 Identities = 38/44 (86%), Positives = 38/44 (86%) Frame = -1 Query: 134 KYIPRIXXXKSGLRKLAXKVPTDRLLKFERVFKAQKRIPMSVFK 3 KY PRI KSGLRKLA KVPTDRLLKFERVFKAQKRI MSVFK Sbjct: 8 KYTPRIKKKKSGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFK 51
>RK22_SACOF (Q6ENS4) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 66.2 bits (160), Expect = 2e-11 Identities = 36/44 (81%), Positives = 36/44 (81%) Frame = -1 Query: 134 KYIPRIXXXKSGLRKLAXKVPTDRLLKFERVFKAQKRIPMSVFK 3 KY PRI GLRKLA KVPTDRLLKFERVFKAQKRI MSVFK Sbjct: 8 KYTPRIKKK-KGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFK 50
>RK22_SACHY (Q6L3F9) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 66.2 bits (160), Expect = 2e-11 Identities = 36/44 (81%), Positives = 36/44 (81%) Frame = -1 Query: 134 KYIPRIXXXKSGLRKLAXKVPTDRLLKFERVFKAQKRIPMSVFK 3 KY PRI GLRKLA KVPTDRLLKFERVFKAQKRI MSVFK Sbjct: 8 KYTPRIKKK-KGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFK 50
>RK22_MAIZE (P06589) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 66.2 bits (160), Expect = 2e-11 Identities = 36/44 (81%), Positives = 36/44 (81%) Frame = -1 Query: 134 KYIPRIXXXKSGLRKLAXKVPTDRLLKFERVFKAQKRIPMSVFK 3 KY PRI GLRKLA KVPTDRLLKFERVFKAQKRI MSVFK Sbjct: 8 KYTPRIKKK-KGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFK 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,871,359 Number of Sequences: 219361 Number of extensions: 149714 Number of successful extensions: 242 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 242 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)