ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd2g07 |
|---|---|
| Clone Library Name | barley_pub |
>SUI1_SALBA (O48650) Protein translation factor SUI1 homolog| Length = 113 Score = 58.5 bits (140), Expect = 4e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PELG + QLQGDQRKNV++FLVQAG+ KKE+IKIHGF Sbjct: 77 PELG-QVIQLQGDQRKNVSSFLVQAGIVKKENIKIHGF 113
>SUI1_SPOST (Q9SM41) Protein translation factor SUI1 homolog| Length = 115 Score = 57.4 bits (137), Expect = 8e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PELG + QLQGDQRKNV+ FLVQAG+ KKE IKIHGF Sbjct: 79 PELG-QVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115
>SUI1_ORYSA (P33278) Protein translation factor SUI1 homolog (GOS2 protein)| Length = 115 Score = 57.4 bits (137), Expect = 8e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PELG + QLQGDQRKNV+ FLVQAG+ KKE IKIHGF Sbjct: 79 PELG-QVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115
>SUI1_MAIZE (P56330) Protein translation factor SUI1 homolog (GOS2 protein)| Length = 115 Score = 57.4 bits (137), Expect = 8e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PELG + QLQGDQRKNV+ FLVQAG+ KKE IKIHGF Sbjct: 79 PELG-QVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115
>SUI12_ARATH (Q94JV4) Protein translation factor SUI1 homolog 2| Length = 113 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 343 QLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 QLQGDQRKNV+TFLVQAGL KK++IKIHGF Sbjct: 84 QLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113
>SUI11_ARATH (P41568) Protein translation factor SUI1 homolog 1| Length = 113 Score = 57.0 bits (136), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 343 QLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 QLQGDQRKNV+TFLVQAGL KK++IKIHGF Sbjct: 84 QLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113
>SUI1_BRAOL (Q9SQF4) Protein translation factor SUI1 homolog (Translation| initiation factor nps45) Length = 113 Score = 55.1 bits (131), Expect = 4e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 343 QLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 QLQGDQRKNV+TFLVQAGL KK+ I+IHGF Sbjct: 84 QLQGDQRKNVSTFLVQAGLVKKDDIQIHGF 113
>SUI1_PIMBR (O82569) Protein translation factor SUI1 homolog| Length = 113 Score = 52.8 bits (125), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 364 ELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 ELG + QLQGDQRKNV+TF+VQAG+ KK+ IK+H F Sbjct: 78 ELG-KVIQLQGDQRKNVSTFIVQAGIVKKDQIKVHNF 113
>EIF1_CHICK (P51971) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) (Fragment) Length = 79 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FLV+ GLAK + +K+HGF Sbjct: 43 PEYG-EVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 79
>EIF1_PONPY (Q5RFF4) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) Length = 113 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FLV+ GLAK + +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113
>EIF1_HUMAN (P41567) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) (Sui1iso1) (A121) Length = 113 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FLV+ GLAK + +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113
>EIF1_BOVIN (Q5E938) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) Length = 113 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FLV+ GLAK + +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113
>EIF1_MOUSE (P48024) Eukaryotic translation initiation factor 1 (eIF1) (Protein| translation factor SUI1 homolog) Length = 113 Score = 48.5 bits (114), Expect = 4e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FL++ GLAK + +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF 113
>EIF1B_PIG (P61220) Eukaryotic translation initiation factor 1b (eIF1b)| (Protein translation factor SUI1 homolog GC20) Length = 113 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FL++ G+ K+E +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113
>EIF1B_MOUSE (Q9CXU9) Eukaryotic translation initiation factor 1b (eIF1b)| Length = 113 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FL++ G+ K+E +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113
>EIF1B_MACFA (Q4R4X9) Eukaryotic translation initiation factor 1b (eIF1b)| Length = 113 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FL++ G+ K+E +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113
>EIF1B_HUMAN (O60739) Eukaryotic translation initiation factor 1b (eIF1b)| (Protein translation factor SUI1 homolog GC20) Length = 113 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQRKN+ FL++ G+ K+E +K+HGF Sbjct: 77 PEYG-EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113
>SUI1_ANOGA (P42678) Protein translation factor SUI1 homolog| Length = 110 Score = 45.4 bits (106), Expect = 3e-05 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQR+N+ +L ++GLAK E +K+HGF Sbjct: 74 PEYG-EVLQLQGDQRENICQWLTKSGLAKPEQLKVHGF 110
>SUI1_DROME (Q9VZS3) Protein translation factor SUI1 homolog| Length = 110 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 PE G QLQGDQR+N+ +L + GLAK + +K+HGF Sbjct: 74 PEYG-EVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF 110
>SUI1_YEAST (P32911) Protein translation factor SUI1| Length = 108 Score = 37.7 bits (86), Expect = 0.007 Identities = 23/39 (58%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 367 PELGPRSSQLQGDQRKNVATFLV-QAGLAKKESIKIHGF 254 PE+G QLQGDQR V F++ Q GL KK +IKIHGF Sbjct: 72 PEMG-EIIQLQGDQRAKVCEFMISQLGLQKK-NIKIHGF 108
>SUI1_ASHGO (Q755R1) Protein translation factor SUI1| Length = 108 Score = 36.2 bits (82), Expect = 0.020 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -1 Query: 343 QLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 QLQGDQR V FL+ K++IKIHGF Sbjct: 79 QLQGDQRAKVCEFLITQLAIPKKNIKIHGF 108
>SUI1_SCHPO (P79060) Protein translation factor sui1| Length = 109 Score = 35.8 bits (81), Expect = 0.026 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -1 Query: 343 QLQGDQRKNVATFLVQAGLAKKESIKIHGF 254 QLQGDQR V FL Q +K++IKIHGF Sbjct: 80 QLQGDQRIKVMEFLTQQLGLQKKNIKIHGF 109
>WISP1_HUMAN (O95388) WNT1-inducible signaling pathway protein 1 precursor| (WISP-1) (Wnt-1-induced secreted protein) Length = 367 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -3 Query: 143 EASVFDALLHPDI*IWHR-CVDASCSSPWSVCATSMAVGLS 24 + FDA+ ++ WHR C+ + +SPWS C+TS +G+S Sbjct: 199 DTGAFDAV--GEVEAWHRNCI--AYTSPWSPCSTSCGLGVS 235
>EFTS_COREF (Q8FP71) Elongation factor Ts (EF-Ts)| Length = 275 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +1 Query: 1 IYLVHNNLDKPTAI--LVAHTDHGEEQLASTHRCQIQMSGCK 120 +YL H + D P ++ LVA+T GEE A+ + +Q++ + Sbjct: 147 VYLHHRSADLPPSVGVLVAYTGEGEEAEAAARQAAMQIAALR 188
>POLG_PVYO (P22602) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3] (Fragment) Length = 856 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 251 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 162 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYC (P22601) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3] (Fragment) Length = 856 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 251 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 162 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYN (P18247) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral gen Length = 3063 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 251 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 162 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYHU (Q02963) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3061 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 251 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 162 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAVESTFYPPTKKHL 597
>HMDH_SCHPO (Q10283) 3-hydroxy-3-methylglutaryl-coenzyme A reductase (EC| 1.1.1.34) (HMG-CoA reductase) Length = 1053 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 131 FDALLHPDI*IWHRCVDASCSSPWSVCATSMAVGLSRLL 15 F + +H I W + AS S W VCA S+++ ++ L Sbjct: 508 FLSTIHSFINNWSHYISASFLSKWIVCALSLSIAVNVFL 546
>Y290_HAEIN (P77868) Probable cation-transporting ATPase HI0290 (EC 3.6.3.-)| Length = 722 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 130 LMLFYIQTFEFGIGVLMQVVLHHGLYAPPVWQW 32 L++ +I F IG+L + H L PP+WQ+ Sbjct: 94 LIVLWIINIPFLIGMLGMIGGSHNLMLPPIWQF 126
>VE1_HPV37 (Q80902) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 609 Score = 27.7 bits (60), Expect = 7.2 Identities = 20/71 (28%), Positives = 29/71 (40%), Gaps = 4/71 (5%) Frame = +2 Query: 44 WWRIQTMVKNNLHQHTDAKFKCLDVKEHQTQT----PHTTTSNANVFRCEDTKYLYDNFQ 211 W I ++N L D F CLD+K P TSN ++ + E +YL+ Sbjct: 489 WDYIDQYLRNGL----DGNFVCLDLKHRAPCQIKFPPLLLTSNMDIMKEERYRYLHSRVH 544 Query: 212 ASVSDNTRAFE 244 A N F+ Sbjct: 545 AFAFPNKFPFD 555
>POLS_EEEV (P08768) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike gl Length = 1239 Score = 27.3 bits (59), Expect = 9.3 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +2 Query: 104 KCLDVKEHQTQTPHTTTSNANVFRCEDTK----YLYDN 205 KC DV+E T + HTTT C D K YL DN Sbjct: 522 KCPDVREGITSSDHTTT-------CTDVKQCRAYLIDN 552
>VIT_ICHUN (Q91062) Vitellogenin precursor (VTG) [Contains: Lipovitellin LV-1N;| Lipovitellin LV-1C; Lipovitellin LV-2] Length = 1823 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 228 LSDTEAWKLSYKYLVSSHLKTFALL 154 LSD WKL K+ +S+H+K A + Sbjct: 1399 LSDLSVWKLCAKFRLSAHMKAKAAI 1423
>ACHA7_CHICK (P22770) Neuronal acetylcholine receptor protein, alpha-7 subunit| precursor Length = 502 Score = 27.3 bits (59), Expect = 9.3 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = -1 Query: 172 EDIC----IASSRVRRLCLMLFYIQTFEFGIGVLM 80 E IC A+S V RLCLM F + T IG+LM Sbjct: 454 EAICNEWKFAASVVDRLCLMAFSVFTIICTIGILM 488
>TENA_PIG (Q29116) Tenascin precursor (TN) (Hexabrachion) (Cytotactin)| (Neuronectin) (GMEM) (JI) (Miotendinous antigen) (Glioma-associated-extracellular matrix antigen) (GP 150-225) (Tenascin-C) (TN-C) (P230) Length = 1746 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 28 KPTAILVAHTDHGEEQLASTHRCQIQMSGCKRASNTD 138 +P+ + HT GE Q+ THR I C A+ D Sbjct: 82 EPSESVQEHTVDGENQIVFTHRINIPRRACGCAAAPD 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,997,974 Number of Sequences: 219361 Number of extensions: 1058347 Number of successful extensions: 3111 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 3053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3110 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
