Clone Name | rbasd2g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_WIGBR (Q8D294) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 29 | 3.0 | 2 | FHAB_BORPE (P12255) Filamentous hemagglutinin | 28 | 5.0 | 3 | IF35_HUMAN (O00303) Eukaryotic translation initiation factor 3 s... | 28 | 6.6 | 4 | TNFL8_MOUSE (P32972) Tumor necrosis factor ligand superfamily me... | 28 | 8.6 |
---|
>SYV_WIGBR (Q8D294) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 881 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 55 PITYTINRNQYPGRLNSTVR 114 PI Y +N+NQYPG S VR Sbjct: 436 PIWYDVNKNQYPGISESDVR 455
>FHAB_BORPE (P12255) Filamentous hemagglutinin| Length = 3590 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 49 GKPITYTINRNQYPGRLNSTVRST 120 GKP TYTINR + +LN V ST Sbjct: 3537 GKPQTYTINRREDLMKLNGKVLST 3560
>IF35_HUMAN (O00303) Eukaryotic translation initiation factor 3 subunit 5| (eIF-3 epsilon) (eIF3 p47 subunit) (eIF3f) Length = 357 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 166 IPGSANAGAPAPTPSMCFXPWNLAAPGT 83 +P +A A PAPTP+ P AAP + Sbjct: 18 VPAAAPASVPAPTPAPAAAPVPAAAPAS 45
>TNFL8_MOUSE (P32972) Tumor necrosis factor ligand superfamily member 8 (CD30| ligand) (CD30-L) (CD153 antigen) Length = 239 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 11/48 (22%) Frame = -1 Query: 157 SANAGAPAPTPSMCFXPWNLAAPGTD-----------FYLSCM*LACL 47 + + GAP+P P+M P ++A+P FYLS L CL Sbjct: 8 AGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCL 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,628,637 Number of Sequences: 219361 Number of extensions: 544946 Number of successful extensions: 1640 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1622 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)