Clone Name | rbasd1p22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KCNH2_MOUSE (O35219) Potassium voltage-gated channel subfamily H... | 32 | 1.6 | 2 | ATG26_DEBHA (Q6BN88) Sterol 3-beta-glucosyltransferase (EC 2.4.1... | 30 | 6.0 | 3 | WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7... | 30 | 6.0 |
---|
>KCNH2_MOUSE (O35219) Potassium voltage-gated channel subfamily H member 2| (Voltage-gated potassium channel subunit Kv11.1) (Ether-a-go-go related gene potassium channel 1) (ERG1) (MERG) (Merg1) (Ether-a-go-go related protein 1) (Eag-related protein 1) Length = 1162 Score = 32.0 bits (71), Expect = 1.6 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = -2 Query: 356 SSNWASSVGAT-----LPLLLRPKCRQNGARQGTLHGRGGPPTTMNMCDLTP 216 S++W +S A LP LL R++ R G++H G P + DLTP Sbjct: 151 STSWLASGRAKTFRLKLPALLALTARESSVRTGSMHSAGAPGAVVVDVDLTP 202
>ATG26_DEBHA (Q6BN88) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1574 Score = 30.0 bits (66), Expect = 6.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 342 LFRGRHSSAAPPTQVPTKWSSPRHTSWTRRTTHDDEHV 229 +FR RH+S + K++S + ++W R TH DE + Sbjct: 595 IFRNRHNS------ISKKYTSEKGSNWNRPFTHKDEEI 626
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1) (Protein| kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 30.0 bits (66), Expect = 6.0 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 319 GRVAPTEEAQLELQSCLTVQVPAYPIEGED*PPKPVAQVQFDGGRPP 459 G+ AP A + S T Q+P+ P+ G PP+P + ++ DG PP Sbjct: 1531 GQPAPLLPAAVGAVSLATSQLPSPPL-GPTVPPQPPSALESDGEGPP 1576 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,637,836 Number of Sequences: 219361 Number of extensions: 1737479 Number of successful extensions: 4286 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4285 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)