ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd2e07 |
|---|---|
| Clone Library Name | barley_pub |
>REV_HV1MA (P04622) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 117 Score = 30.8 bits (68), Expect = 0.80 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GR E P PL P R T CN D G S Sbjct: 61 LSTYLGRPEEPVPLQLPPLERLTLNCNEDCGTS 93
>REV_HV1BN (P12485) REV protein (Anti-repression transactivator protein)| (ART/TRS) (Fragment) Length = 106 Score = 30.4 bits (67), Expect = 1.0 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +3 Query: 90 STFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 S + LS+ +GRS P PL P R T CN D G S Sbjct: 46 SGWILSTFLGRSAEPVPLQLPPLERLTLDCNEDCGTS 82
>REV_HV1PV (P69719) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 60 LSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV1H3 (P69718) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 60 LSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV1BR (P04620) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 60 LSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV1B1 (P04616) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 60 LSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV112 (P04325) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 60 LSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 92
>GLI1_XENLA (Q91690) Zinc finger protein GLI1 (GLI-1) (Fragment)| Length = 1360 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 195 DQHPNCTARLTGMGDGSSEETDTRSDQHQN 106 +QHP A +T GD + DTR +QH+N Sbjct: 1083 EQHPKSMAMMTNSGD----DVDTRQNQHKN 1108
>REV_HV1B8 (P05864) REV protein (Anti-repression transactivator protein)| (ART/TRS) (Fragment) Length = 106 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 50 LSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 82
>REV_HV1LW (Q70624) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 118 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T CN D G S Sbjct: 62 LSTYLGRSAKPVPLQLPPLERLTLDCNEDCGTS 94
>REV_HV1C4 (P05865) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 90 STFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 S + LS+ +GRS P PL P R T C+ D G S Sbjct: 56 SAWLLSTCLGRSAEPVPLQLPPLERLTLDCSEDCGTS 92
>REV_HV1Z6 (P04619) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRSE P PL P R C+ D G S Sbjct: 60 LSTYLGRSEEPVPLQLPPLERLNLNCSEDCGTS 92
>REV_HV1A2 (P04623) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 90 STFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 S + LS+ +GRS P PL P R T C+ D G S Sbjct: 56 SGWILSTYLGRSAEPVPLQLPPLERLTLDCSEDCGNS 92
>REV_HV1Z2 (P12483) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 118 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRSE P PL P R C+ D G S Sbjct: 60 LSTYLGRSEEPVPLQLPPLERLNLNCSEDCGAS 92
>REV_HV1SC (P05872) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 90 STFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 S + LS+ +GR P PL P R T CN D G S Sbjct: 56 SGWILSNYLGRLAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV1S3 (P19547) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T C+ D G S Sbjct: 60 LSTVLGRSSEPVPLQLPPLDRLTLDCSEDCGTS 92
>REV_HV1JR (P20869) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +3 Query: 84 TNSTFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 T S LS+ +GR P PL P R T CN D G S Sbjct: 54 TISERILSTYLGRPAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV1H2 (P04618) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 L + +GRS P PL P R T CN D G S Sbjct: 60 LGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTS 92
>REV_HV1Z8 (P05869) REV protein (Anti-repression transactivator protein)| (ART/TRS) (Fragment) Length = 90 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R CN D G S Sbjct: 34 LSTLLGRSPEPVPLQLPPLERLNLNCNEDCGTS 66
>REV_HV1J3 (P12484) REV protein (Anti-repression transactivator protein)| (ART/TRS) (Fragment) Length = 113 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 90 STFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 S + +S+ +GR P PL P R T CN D G S Sbjct: 53 SGWIISNYLGRPAEPVPLQLPPLERLTLDCNEDCGTS 89
>REV_HV1S1 (P19548) REV protein (Anti-repression transactivator protein)| (ART/TRS) Length = 116 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 90 STFYLSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 S + +S+ +GRS P PL P R C+ D G S Sbjct: 56 SAWIISTHLGRSTEPVPLQLPPLERLNLDCSEDCGTS 92
>REV_HV1W2 (P05866) REV protein (Anti-repression transactivator protein)| (ART/TRS) (Fragment) Length = 90 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 102 LSSDVGRSEYPSPLNCRPPFRSTERCNSDVGRS 200 LS+ +GRS P PL P R T C D G S Sbjct: 34 LSTYLGRSAEPVPLQLPPLERLTLDCEEDCGTS 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,941,610 Number of Sequences: 219361 Number of extensions: 586950 Number of successful extensions: 1511 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1511 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
