Clone Name | rbasd2e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VGLB_EBV (P03188) Glycoprotein GP110 precursor (GP115) | 29 | 3.5 | 2 | STC_DROME (P40798) Protein shuttle craft | 28 | 7.8 | 3 | ELOV2_MOUSE (Q9JLJ4) Elongation of very long chain fatty acids p... | 28 | 7.8 |
---|
>VGLB_EBV (P03188) Glycoprotein GP110 precursor (GP115)| Length = 857 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +2 Query: 86 KGTKYVHYF---PGNILQWLVLTVRALLEHRNFTEIAQST 196 KG + + YF G +L WL LT R+L +N TE+ T Sbjct: 364 KGQEAITYFITSGGLLLAWLPLTPRSLATVKNLTELTTPT 403
>STC_DROME (P40798) Protein shuttle craft| Length = 1106 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 79 NRKRNKICTLFSREHSSMACIDSTS 153 NRK+N+ C +REHS +A I S Sbjct: 906 NRKQNRSCQELAREHSRIATIQLAS 930
>ELOV2_MOUSE (Q9JLJ4) Elongation of very long chain fatty acids protein 2| Length = 292 Score = 27.7 bits (60), Expect = 7.8 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 7/53 (13%) Frame = +1 Query: 61 TIYFIYNRKRNKICTLFSREHSSMA----CIDSTSPFGTQKFY---RNSSIHI 198 TI+F+ +K N+I L H+SM C+ + P G Q F+ NS IHI Sbjct: 130 TIFFVLRKKTNQITFLHVYHHASMFNIWWCVLNWIPCG-QSFFGPTLNSFIHI 181 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,112,177 Number of Sequences: 219361 Number of extensions: 755976 Number of successful extensions: 1658 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1658 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)