ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd1n19 |
|---|---|
| Clone Library Name | barley_pub |
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 200 bits (509), Expect = 2e-51 Identities = 97/137 (70%), Positives = 105/137 (76%), Gaps = 3/137 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 +RVELPDAYPYKSPS+GFI KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQL Sbjct: 51 IRVELPDAYPYKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQL 110 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPEDAG---ITPXXXXXXXXXXX 233 LLYPNPSDPLNGEAAALMMRDRPAYEQ+VKE+C+KYAKP + + Sbjct: 111 LLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSD 170 Query: 232 XXXXXXXXXDIVGKPDP 182 I GKPDP Sbjct: 171 NEDDDDDDVAIAGKPDP 187
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 199 bits (507), Expect = 4e-51 Identities = 91/99 (91%), Positives = 96/99 (96%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 +RVELPDAYPYKSPS+GFI KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQL Sbjct: 51 IRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQL 110 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKP 287 LLYPNPSDPLNGEAAALMMRDRP YEQ+VKE+C+KYAKP Sbjct: 111 LLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAKP 149
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 195 bits (496), Expect = 7e-50 Identities = 90/101 (89%), Positives = 97/101 (96%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 VRVEL +AYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN+FEVFLPQL Sbjct: 51 VRVELTEAYPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQL 110 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPED 281 LLYPNPSDPLNGEAA+LMMRD+ AYE KVKE+C++YAKPED Sbjct: 111 LLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCERYAKPED 151
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 191 bits (485), Expect = 1e-48 Identities = 90/134 (67%), Positives = 105/134 (78%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 ++VELP+AYPYKSPS+GF+NKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQL Sbjct: 51 IKVELPEAYPYKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQL 110 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPEDAGITPXXXXXXXXXXXXXX 224 LLYPNPSDP NGEAA+L+MRDR AYE KVKE+C+KYAKPE+ ++ Sbjct: 111 LLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCEKYAKPEEI-LSDDDDDDSMSEDGSDS 169 Query: 223 XXXXXXDIVGKPDP 182 +IVGK DP Sbjct: 170 DDDDDDEIVGKADP 183
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 152 bits (385), Expect = 5e-37 Identities = 67/100 (67%), Positives = 83/100 (83%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 VRV+LPD YP+KSPSIGF+NKI+HPN+DE SG+VCLDVINQTW+ ++DL N+FE FLPQL Sbjct: 53 VRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQL 112 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPE 284 L YPNP DPLNG+AAA+ + Y+QK+KE+ KYA E Sbjct: 113 LAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEE 152
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 152 bits (385), Expect = 5e-37 Identities = 67/100 (67%), Positives = 83/100 (83%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 VRV+LPD YP+KSPSIGF+NKI+HPN+DE SG+VCLDVINQTW+ ++DL N+FE FLPQL Sbjct: 53 VRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQL 112 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPE 284 L YPNP DPLNG+AAA+ + Y+QK+KE+ KYA E Sbjct: 113 LAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEE 152
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 147 bits (372), Expect = 2e-35 Identities = 65/100 (65%), Positives = 80/100 (80%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 + VELPD YPYKSPSIGF+NKI+HPN+D SGS+CLDVIN TWSP++DL+N+ E +P L Sbjct: 51 LHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGL 110 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPE 284 L PN SDPLN EAA L +RD+ YE+K+KE+ DKYA E Sbjct: 111 LKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYATKE 150
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 82.0 bits (201), Expect = 1e-15 Identities = 38/95 (40%), Positives = 55/95 (57%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ P YP+K P + F +IYHPNV+ +GS+CLD++ WSP + V + + LL Sbjct: 54 IDFPTEYPFKPPKVEFTTRIYHPNVNS-NGSICLDILRSQWSPALTISKVL-LSISSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYA 146
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 81.6 bits (200), Expect = 1e-15 Identities = 38/95 (40%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y Q +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYA 146
>UBC4_YEAST (P15731) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 148 Score = 81.6 bits (200), Expect = 1e-15 Identities = 40/95 (42%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P I F KIYHPN++ +G++CLD++ WSP L V + + LL Sbjct: 55 IHFPTDYPFKPPKISFTTKIYHPNIN-ANGNICLDILKDQWSPALTLSKVL-LSICSLLT 112 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 NP DPL E A + DRP YE +E+ KYA Sbjct: 113 DANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYA 147
>UBC11_ARATH (P35134) Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19)| (Ubiquitin-protein ligase 11) (Ubiquitin carrier protein 11) Length = 148 Score = 81.6 bits (200), Expect = 1e-15 Identities = 38/97 (39%), Positives = 55/97 (56%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V + P YP+K P + F K+YHPN++ +GS+CLD++ + WSP + V + + L Sbjct: 52 VSIHFPPDYPFKPPKVSFKTKVYHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSL 109 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L PNP DPL E A + DR YE + + KYA Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYA 146
>UBC4_SCHPO (P46595) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 80.1 bits (196), Expect = 4e-15 Identities = 38/95 (40%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVNFTTRIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSLLT 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR YE +E+ KYA Sbjct: 112 DPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYA 146
>UBC5_YEAST (P15732) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 80.1 bits (196), Expect = 4e-15 Identities = 39/95 (41%), Positives = 53/95 (55%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F KIYHPN++ SG++CLD++ WSP L V + + LL Sbjct: 55 IHFPTDYPFKPPKVNFTTKIYHPNINS-SGNICLDILKDQWSPALTLSKVL-LSICSLLT 112 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 NP DPL E A + D+ YE KE+ KYA Sbjct: 113 DANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYA 147
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 80.1 bits (196), Expect = 4e-15 Identities = 36/103 (34%), Positives = 58/103 (56%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V +E+P YP+K P + F K+YHPN+ ++G++CLD++ WSP+ L + + L L Sbjct: 54 VDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSAL-ISLQAL 112 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPEDAG 275 L P P+DP + E A +RDR ++ + + YA G Sbjct: 113 LQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYASETSNG 155
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 146
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 38/95 (40%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 V P YP+K P I F KIYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 VHFPTDYPFKPPKIAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL + A + D+ Y + +E+ KYA Sbjct: 112 DPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYA 146
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 79.7 bits (195), Expect = 6e-15 Identities = 38/95 (40%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 V P YP+K P I F KIYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 VHFPTDYPFKPPKIAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL + A + D+ Y + +E+ KYA Sbjct: 112 DPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYA 146
>UBC8_ARATH (P35131) Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC 6.3.2.19)| (Ubiquitin-protein ligase 8) (Ubiquitin carrier protein 8) (UBCAT4A) Length = 148 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/97 (38%), Positives = 55/97 (56%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V + P YP+K P + F K++HPN++ +GS+CLD++ + WSP + V + + L Sbjct: 52 VTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSL 109 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L PNP DPL E A + DR YE + + KYA Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYA 146
>UBC4_LYCES (P35135) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/97 (38%), Positives = 55/97 (56%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V + P YP+K P + F K++HPN++ +GS+CLD++ + WSP + V + + L Sbjct: 52 VSIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSL 109 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L PNP DPL E A + DR YE + + KYA Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 146
>UBC12_SCHPO (O74549) NEDD8-conjugating enzyme ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 177 Score = 79.3 bits (194), Expect = 7e-15 Identities = 38/89 (42%), Positives = 58/89 (65%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLL 401 R+++ D YP+ P + +NKIYHPN+D + G+VCL+++ Q W+P+ +L N V L L Sbjct: 73 RIQIDDNYPHDPPKVKCLNKIYHPNID-IEGNVCLNILRQDWNPVLNL-NSILVGLQFLF 130 Query: 400 LYPNPSDPLNGEAAALMMRDRPAYEQKVK 314 L PN DPLN EAAA + +D + +V+ Sbjct: 131 LSPNAEDPLNKEAAADLHKDPQGFASRVR 159
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 79.0 bits (193), Expect = 9e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYA 146
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 79.0 bits (193), Expect = 9e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYA 146
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 79.0 bits (193), Expect = 9e-15 Identities = 37/95 (38%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVL-LSICSLLC 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + DR Y + +E+ KYA Sbjct: 112 DPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYA 146
>UBC10_ARATH (P35133) Ubiquitin-conjugating enzyme E2-17 kDa 10/12 (EC 6.3.2.19)| (Ubiquitin-protein ligase 10/12) (Ubiquitin carrier protein 10/12) Length = 148 Score = 78.6 bits (192), Expect = 1e-14 Identities = 36/97 (37%), Positives = 55/97 (56%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V + P YP+K P + F K++HPN++ +GS+CLD++ + WSP + V + + L Sbjct: 52 VTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSL 109 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L PNP DPL E A + D+ YE + + KYA Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYA 146
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/94 (39%), Positives = 56/94 (59%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LPD YP ++P + F+ KIYHPN+D + G +CLDV+ WSP + V + + LL P Sbjct: 58 LPDDYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSIQALLASP 115 Query: 391 NPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 NP+DPL + A +++ + K +E+ YAK Sbjct: 116 NPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAK 149
>UBC9_ARATH (P35132) Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B) Length = 148 Score = 78.2 bits (191), Expect = 2e-14 Identities = 36/97 (37%), Positives = 55/97 (56%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V + P YP+K P + F K++HPN++ +GS+CLD++ + WSP + V + + L Sbjct: 52 VTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSL 109 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L PNP DPL E A + D+ YE + + KYA Sbjct: 110 LTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYA 146
>UBC1_COLGL (O74196) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) Length = 147 Score = 77.8 bits (190), Expect = 2e-14 Identities = 36/95 (37%), Positives = 54/95 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + +L Sbjct: 54 IHFPTDYPFKPPKVNFTTRIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSMLT 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP +PL E A + DR YE +E+ KYA Sbjct: 112 DPNPDEPLVPEIAHVYKTDRARYEATAREWTRKYA 146
>UBC12_ASHGO (Q75AF2) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 76.6 bits (187), Expect = 5e-14 Identities = 39/84 (46%), Positives = 55/84 (65%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 D YP + P++ +N IYHPN+D SG++CL+V+ + WSP+ DL V + L L L PN Sbjct: 85 DTYPIEPPTVKCLNTIYHPNID-YSGNICLNVLREDWSPVMDLQTVV-LGLLFLFLEPNG 142 Query: 385 SDPLNGEAAALMMRDRPAYEQKVK 314 SDPLN +AA M+RD +E V+ Sbjct: 143 SDPLNRQAADTMLRDPYRFETNVQ 166
>UBC1_MAGGR (Q9UVR2) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 147 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/95 (37%), Positives = 53/95 (55%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP+K P + F +IYHPN++ +GS+CLD++ WSP + V + + +L Sbjct: 54 IHFPTDYPFKPPKVNFTTRIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSMLT 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PNP DPL E A + R YE +E+ KYA Sbjct: 112 DPNPDDPLVPEIAHVYRTARAQYEATAREWTPKYA 146
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 76.3 bits (186), Expect = 6e-14 Identities = 35/88 (39%), Positives = 53/88 (60%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV G +CLD++ WSP +D V+ + LL Sbjct: 57 IEFTEEYPNKPPTVRFVSKVFHPNV-YADGGICLDILQNRWSPTYD-VSAILTSIQSLLS 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVK 314 PNP+ P N AA L +R YE++VK Sbjct: 115 DPNPNSPANSTAAQLYKENRREYEKRVK 142
>UBC4_CANAL (P43102) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 76.3 bits (186), Expect = 6e-14 Identities = 38/95 (40%), Positives = 52/95 (54%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + P YP K P I KIYHPN++ +G++CLD++ WSP + V + + LL Sbjct: 54 IHFPTDYPLKPPKIALTTKIYHPNINS-NGNICLDILKDQWSPALTISKVL-LSICSLLT 111 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 NP DPL E A + +DR YE KE+ KYA Sbjct: 112 DANPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYA 146
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 75.9 bits (185), Expect = 8e-14 Identities = 35/93 (37%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ FI+K++HPNV GS+CLD++ WSP +D+ + + LL Sbjct: 57 LEFTEEYPNKPPTVKFISKMFHPNV-YADGSICLDILQNRWSPTYDVAAIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N AA L +R YE++V++ ++ Sbjct: 115 EPNPNSPANSLAAQLYQENRREYEKRVQQIVEQ 147
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 75.9 bits (185), Expect = 8e-14 Identities = 33/93 (35%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV GS+CLD++ WSP +D+ ++ + LL Sbjct: 57 IEFTEEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N +AA L ++ YE++V ++ Sbjct: 115 EPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 147
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 75.9 bits (185), Expect = 8e-14 Identities = 33/93 (35%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV GS+CLD++ WSP +D+ ++ + LL Sbjct: 57 IEFTEEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N +AA L ++ YE++V ++ Sbjct: 115 EPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 75.5 bits (184), Expect = 1e-13 Identities = 33/93 (35%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV GS+CLD++ WSP +D+ ++ + LL Sbjct: 57 IEFSEEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N +AA L ++ YE++V ++ Sbjct: 115 EPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 75.5 bits (184), Expect = 1e-13 Identities = 33/93 (35%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV GS+CLD++ WSP +D+ ++ + LL Sbjct: 57 IEFSEEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N +AA L ++ YE++V ++ Sbjct: 115 EPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 75.5 bits (184), Expect = 1e-13 Identities = 33/93 (35%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV GS+CLD++ WSP +D+ ++ + LL Sbjct: 57 IEFSEEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N +AA L ++ YE++V ++ Sbjct: 115 EPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 147
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 75.5 bits (184), Expect = 1e-13 Identities = 33/93 (35%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P++ F++K++HPNV GS+CLD++ WSP +D+ ++ + LL Sbjct: 57 IEFSEEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLD 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N +AA L ++ YE++V ++ Sbjct: 115 EPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 147
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 75.1 bits (183), Expect = 1e-13 Identities = 31/93 (33%), Positives = 58/93 (62%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P++ F+++++HPN+ GS+CLD++ WSP++D+ + + LL Sbjct: 57 LQFTEDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLC 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA + ++ Y +KV+E ++ Sbjct: 115 DPNPNSPANSEAARMYSENKREYNRKVREVVEQ 147
>UBC13_SCHPO (O13685) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 148 Score = 74.7 bits (182), Expect = 2e-13 Identities = 35/93 (37%), Positives = 53/93 (56%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LPD YP P++ F+ KIYHPNVD++ G +CL + + WSP + V + + L+ P Sbjct: 57 LPDEYPMMPPNVRFLTKIYHPNVDKL-GRICLSTLKKDWSPALQIRTVL-LSIQALMGAP 114 Query: 391 NPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 NP DPL+ + A + + P +E+ KYA Sbjct: 115 NPDDPLDNDVAKIWKENEPQAIANAREWTKKYA 147
>UBCD3_DROME (P35128) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein bendless) Length = 151 Score = 74.7 bits (182), Expect = 2e-13 Identities = 36/93 (38%), Positives = 52/93 (55%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LP+ YP +P + FI KIYHPN+D + G +CLDV+ WSP + + + + LL P Sbjct: 58 LPEDYPMSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRTIL-LSIQALLSAP 115 Query: 391 NPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 NP DPL + A L + + +E+ KYA Sbjct: 116 NPDDPLANDVAELWKVNEAEAIRNAREWTQKYA 148
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 74.3 bits (181), Expect = 2e-13 Identities = 30/93 (32%), Positives = 58/93 (62%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P++ F+++++HPN+ GS+CLD++ WSP++D+ + + LL Sbjct: 57 LQFSEDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLC 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA + ++ Y ++V+E ++ Sbjct: 115 DPNPNSPANSEAARMFSENKREYNRRVREVVEQ 147
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/99 (33%), Positives = 62/99 (62%), Gaps = 1/99 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT-WSPMFDLVNVFEVFLPQ 407 + +EL + YPY SP + FI I H NV++ G +CL+++ + W+ +++++ + Sbjct: 58 LEIELSNDYPYSSPKVKFITPIQHMNVND-KGDICLNILKKDGWNASLNIISIIWSIIV- 115 Query: 406 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 LL PNP DP N E A+L D+ +Y++K++++C ++K Sbjct: 116 LLDQPNPEDPFNSELASLYRNDKLSYDKKIRDYCKTHSK 154
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 73.9 bits (180), Expect = 3e-13 Identities = 30/93 (32%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P++ F+++++HPN+ GS+CLD++ WSP++D+ + + LL Sbjct: 57 LQFSEDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLC 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA + + Y ++V+E ++ Sbjct: 115 DPNPNSPANSEAARMFSESKREYNRRVREVVEQ 147
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 73.6 bits (179), Expect = 4e-13 Identities = 34/85 (40%), Positives = 54/85 (63%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 DAYP K P++ FI+K++HPN+ +G +CLD++ WSP +D+ + + LL PNP Sbjct: 61 DAYPNKPPTVRFISKMFHPNI-YANGELCLDILQNRWSPTYDVAAIL-TSVQSLLNDPNP 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVKE 311 + P N +AA L + YE++VK+ Sbjct: 119 ASPANVDAAQLFKENLKEYERRVKK 143
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 72.8 bits (177), Expect = 7e-13 Identities = 33/87 (37%), Positives = 52/87 (59%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP K P + F+++++HPN+ GS+CLD++ WSP++D+ V + LL PNP Sbjct: 63 YPNKPPIVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAVL-TSIQSLLCDPNPDS 120 Query: 379 PLNGEAAALMMRDRPAYEQKVKEFCDK 299 P N EAA L ++ Y +KV E ++ Sbjct: 121 PANAEAARLFSENKREYNRKVIEIVEQ 147
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 72.4 bits (176), Expect = 9e-13 Identities = 29/93 (31%), Positives = 57/93 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P++ F+++++HPN+ GS+CLD++ WSP++D+ + + LL Sbjct: 57 LQFSEDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLC 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA + + Y ++V++ ++ Sbjct: 115 DPNPNSPANSEAARMYSESKREYNRRVRDVVEQ 147
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/83 (38%), Positives = 53/83 (63%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP++ P + ++YHPN+D + G+VCL+++ + W+P+ + +N L L L PNP D Sbjct: 83 YPHEPPKVKCATQVYHPNID-LDGNVCLNILREDWNPVLN-INSIVYGLQFLFLEPNPED 140 Query: 379 PLNGEAAALMMRDRPAYEQKVKE 311 PLN EAA ++ +R +E VK+ Sbjct: 141 PLNKEAADVLQTNRRQFENNVKK 163
>UBC2_KLULA (Q6CUD9) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 164 Score = 71.2 bits (173), Expect = 2e-12 Identities = 32/93 (34%), Positives = 55/93 (59%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P + F+++++HPNV +G +CLD++ W+P +D+ ++ + L Sbjct: 57 LEFDEEYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA L + Y ++VKE +K Sbjct: 115 DPNPASPANVEAATLFQDHKSQYVKRVKETVEK 147
>UBC2_YEAST (P06104) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 172 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/93 (34%), Positives = 55/93 (59%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P + F+++++HPNV +G +CLD++ W+P +D+ ++ + L Sbjct: 57 LEFDEEYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA L + Y ++VKE +K Sbjct: 115 DPNPASPANVEAATLFKDHKSQYVKRVKETVEK 147
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 +P++ P + + K+YHPN+D + G+VCL+++ + W P+ L N + L L L PN SD Sbjct: 81 FPHEPPKVKCLQKVYHPNID-LEGNVCLNILREDWKPVLSL-NAVMIGLQYLFLEPNASD 138 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 PLN +AA M +R +++ VK Sbjct: 139 PLNKDAAHQMTANREEFKRNVK 160
>UBC12_YEAST (P52491) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 188 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/88 (36%), Positives = 54/88 (61%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP + P + + KI+HPN+D + G+VCL+++ + WSP DL ++ L L L Sbjct: 84 LDFNEVYPIEPPKVVCLKKIFHPNID-LKGNVCLNILREDWSPALDLQSIITGLL-FLFL 141 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVK 314 PNP+DPLN +AA L+ + + V+ Sbjct: 142 EPNPNDPLNKDAAKLLCEGEKEFAEAVR 169
>UBC2_ASHGO (Q75EB8) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 170 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/93 (34%), Positives = 55/93 (59%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P + F+++++HPNV +G +CLD++ W+P +D+ ++ + L Sbjct: 57 LEFDEEYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA L + Y ++VKE +K Sbjct: 115 DPNPASPANVEAATLFKDHKSQYVKRVKETVEK 147
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/84 (38%), Positives = 53/84 (63%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 ++YP K P++ F++K++HPNV +G +CLD++ WSP +D+ + + LL PNP Sbjct: 61 ESYPNKPPTVKFLSKMFHPNV-YANGELCLDILQNRWSPTYDVAAIL-TSIQSLLHDPNP 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVK 314 + P N EAA+L + Y ++VK Sbjct: 119 NSPANAEAASLYRENMKEYVRRVK 142
>UBC2_CANGA (Q6FR76) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 167 Score = 70.1 bits (170), Expect = 4e-12 Identities = 32/93 (34%), Positives = 55/93 (59%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E + YP K P + F+++++HPNV +G +CLD++ W+P +D+ ++ + L Sbjct: 57 LEFDEDYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PNP+ P N EAA L + Y ++VKE +K Sbjct: 115 DPNPASPANVEAATLFKDHKSQYIKRVKETVEK 147
>UBE2C_MOUSE (Q9D1C1) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 69.3 bits (168), Expect = 8e-12 Identities = 35/99 (35%), Positives = 56/99 (56%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E P YPY +P++ F+ YHPNVD G++CLD++ WS ++D V + + LL Sbjct: 83 LEFPSGYPYNAPTVKFLTPCYHPNVD-TQGNICLDILKDKWSALYD-VRTILLSIQSLLG 140 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPED 281 PN PLN AA L ++ A+++ ++E K +D Sbjct: 141 EPNIDSPLNTHAAEL-WKNPTAFKKYLQETYSKQVSSQD 178
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 32/82 (39%), Positives = 49/82 (59%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+ P + +YHPN+D + G+VCL+++ + W P+ +N L L L PNP D Sbjct: 86 YPHDPPKVKCETMVYHPNID-LEGNVCLNILREDWKPVLT-INSIIYGLQYLFLEPNPED 143 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 PLN EAA ++ +R +EQ V+ Sbjct: 144 PLNKEAAEVLQNNRRLFEQNVQ 165
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 32/82 (39%), Positives = 49/82 (59%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+ P + +YHPN+D + G+VCL+++ + W P+ +N L L L PNP D Sbjct: 86 YPHDPPKVKCETMVYHPNID-LEGNVCLNILREDWKPVLT-INSIIYGLQYLFLEPNPED 143 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 PLN EAA ++ +R +EQ V+ Sbjct: 144 PLNKEAAEVLQNNRRLFEQNVQ 165
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 32/82 (39%), Positives = 49/82 (59%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+ P + +YHPN+D + G+VCL+++ + W P+ +N L L L PNP D Sbjct: 86 YPHDPPKVKCETMVYHPNID-LEGNVCLNILREDWKPVLT-INSIIYGLQYLFLEPNPED 143 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 PLN EAA ++ +R +EQ V+ Sbjct: 144 PLNKEAAEVLQNNRRLFEQNVQ 165
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 69.3 bits (168), Expect = 8e-12 Identities = 32/82 (39%), Positives = 49/82 (59%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+ P + +YHPN+D + G+VCL+++ + W P+ +N L L L PNP D Sbjct: 86 YPHDPPKVKCETMVYHPNID-LEGNVCLNILREDWKPVLT-INSIIYGLQYLFLEPNPED 143 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 PLN EAA ++ +R +EQ V+ Sbjct: 144 PLNKEAAEVLQNNRRLFEQNVQ 165
>UBC2_DEBHA (Q6BU36) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 168 Score = 69.3 bits (168), Expect = 8e-12 Identities = 36/99 (36%), Positives = 57/99 (57%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K PS+ FI++++HPNV SG +CLD++ WSP +D+ ++ + LL Sbjct: 57 LQFDEQYPNKPPSVKFISEMFHPNV-YASGELCLDILQNRWSPTYDVSSIL-TSIQSLLN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPED 281 PN S P N EAA L R Y ++V+E + +D Sbjct: 115 DPNISSPANVEAANLYKDHRSQYIKRVRETVENSWNEDD 153
>UB2EC_XENLA (P56616) Ubiquitin-conjugating enzyme X (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UBC-X) Length = 179 Score = 68.9 bits (167), Expect = 1e-11 Identities = 35/99 (35%), Positives = 57/99 (57%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E P YPY +P++ F+ +HPNVD G++CLD++ WS ++D V + L LL Sbjct: 83 LEFPSGYPYNAPTVKFVTPCFHPNVDS-HGNICLDILKDKWSALYD-VRTILLSLQSLLG 140 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPED 281 PN PLN AA L +++ AY++ + E K + ++ Sbjct: 141 EPNNESPLNPYAAEL-WQNQTAYKKHLHEQYQKQVREKE 178
>UBE2N_MACFA (Q4R4I1) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/71 (45%), Positives = 44/71 (61%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LP+ YP +P + F+ KIYHPNVD+ SG +CLD++ WSP + V + + LL P Sbjct: 58 LPEEYPMAAPKVRFMTKIYHPNVDK-SGRICLDILKDKWSPALQIRTVL-LSIQALLSAP 115 Query: 391 NPSDPLNGEAA 359 NP DPL + A Sbjct: 116 NPDDPLANDVA 126
>UBC11_SCHPO (O00103) Ubiquitin-conjugating enzyme E2-20 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 176 Score = 68.9 bits (167), Expect = 1e-11 Identities = 33/87 (37%), Positives = 54/87 (62%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 + + P YPY P+I F + ++HPNVD MSG++CLD++ WS ++++ + + L L Sbjct: 80 ISMSFPANYPYSPPTIIFTSPMWHPNVD-MSGNICLDILKDKWSAVYNVQTIL-LSLQSL 137 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQ 323 L PN + PLN +AA L +D Y++ Sbjct: 138 LGEPNNASPLNAQAAELWSKDPIEYKR 164
>UBC11_YEAST (P52492) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 156 Score = 68.9 bits (167), Expect = 1e-11 Identities = 34/89 (38%), Positives = 54/89 (60%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 V ++ P YP+ P I F++ ++HPNVD+ SG++CLD++ + WS ++++ + + L L Sbjct: 60 VSLKFPQNYPFHPPMIKFLSPMWHPNVDK-SGNICLDILKEKWSAVYNVETIL-LSLQSL 117 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKV 317 L PN PLN AA L D Y +KV Sbjct: 118 LGEPNNRSPLNAVAAELWDADMEEYRKKV 146
>UBE2T_HUMAN (Q9NPD8) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 197 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/102 (31%), Positives = 59/102 (57%), Gaps = 4/102 (3%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI----NQTWSPMFDLVNVFEVF 416 + V +P+ YP++ P I F+ IYHPN+D +G +CLDV+ W P ++ V Sbjct: 53 LEVIIPERYPFEPPQIRFLTPIYHPNIDS-AGRICLDVLKLPPKGAWRPSLNIATVL-TS 110 Query: 415 LPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 + L+ PNP DPL + ++ ++PA+ + +++ +K+A+ Sbjct: 111 IQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHAR 152
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 68.6 bits (166), Expect = 1e-11 Identities = 32/89 (35%), Positives = 54/89 (60%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P++ F+++++HPNV SG +CLD++ WSP +D+ + + LL Sbjct: 57 LQFDEQYPNKPPAVKFVSQMFHPNV-YSSGELCLDILQNRWSPTYDVAAIL-TSVQSLLN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKE 311 PN S P N EA+ L R YE++V++ Sbjct: 115 DPNTSSPANVEASMLYKDHRQQYEKRVRD 143
>UBE2C_HUMAN (O00762) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 68.2 bits (165), Expect = 2e-11 Identities = 34/99 (34%), Positives = 57/99 (57%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E P YPY +P++ F+ YHPNVD G++CLD++ + WS ++D V + + LL Sbjct: 83 LEFPSGYPYNAPTVKFLTPCYHPNVD-TQGNICLDILKEKWSALYD-VRTILLSIQSLLG 140 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPED 281 PN PLN AA L ++ A+++ ++E K ++ Sbjct: 141 EPNIDSPLNTHAAEL-WKNPTAFKKYLQETYSKQVTSQE 178
>UBE2N_RAT (Q9EQX9) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LP+ YP +P + F+ KIYHPNVD++ G +CLD++ WSP + V + + LL P Sbjct: 58 LPEEYPMAAPKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAP 115 Query: 391 NPSDPLNGEAA 359 NP DPL + A Sbjct: 116 NPDDPLANDVA 126
>UBE2N_PONPY (Q5R7J6) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LP+ YP +P + F+ KIYHPNVD++ G +CLD++ WSP + V + + LL P Sbjct: 58 LPEEYPMAAPKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAP 115 Query: 391 NPSDPLNGEAA 359 NP DPL + A Sbjct: 116 NPDDPLANDVA 126
>UBE2N_MOUSE (P61089) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LP+ YP +P + F+ KIYHPNVD++ G +CLD++ WSP + V + + LL P Sbjct: 58 LPEEYPMAAPKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAP 115 Query: 391 NPSDPLNGEAA 359 NP DPL + A Sbjct: 116 NPDDPLANDVA 126
>UBE2N_HUMAN (P61088) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = -1 Query: 571 LPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYP 392 LP+ YP +P + F+ KIYHPNVD++ G +CLD++ WSP + V + + LL P Sbjct: 58 LPEEYPMAAPKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAP 115 Query: 391 NPSDPLNGEAA 359 NP DPL + A Sbjct: 116 NPDDPLANDVA 126
>UBC2_NECHA (P78717) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 151 Score = 67.4 bits (163), Expect = 3e-11 Identities = 33/93 (35%), Positives = 54/93 (58%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P + FI++++HPNV +G +CLD++ WSP +D+ V + LL Sbjct: 57 MQFEEQYPNKPPQVKFISEMFHPNV-YATGELCLDILQNRWSPTYDVAAVL-TSIQSLLN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PN P N EA+ L +R Y ++V+E +K Sbjct: 115 DPNTGSPANVEASNLYKDNRKEYTKRVRETVEK 147
>UB2L3_MOUSE (P68037) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) Length = 154 Score = 67.0 bits (162), Expect = 4e-11 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 1/99 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNVFEVFLPQ 407 + + P YP+K P I F KIYHPN+DE G VCL VI+ + W P V + + Sbjct: 53 IEINFPAEYPFKPPKITFKTKIYHPNIDE-KGQVCLPVISAENWKPATKTDQVIQSLI-A 110 Query: 406 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 L+ P P PL + A +DR + + +EF KY + Sbjct: 111 LVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGE 149
>UB2L3_HUMAN (P68036) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 67.0 bits (162), Expect = 4e-11 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 1/99 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNVFEVFLPQ 407 + + P YP+K P I F KIYHPN+DE G VCL VI+ + W P V + + Sbjct: 53 IEINFPAEYPFKPPKITFKTKIYHPNIDE-KGQVCLPVISAENWKPATKTDQVIQSLI-A 110 Query: 406 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 L+ P P PL + A +DR + + +EF KY + Sbjct: 111 LVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGE 149
>UBC2_CANAL (O74201) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 179 Score = 67.0 bits (162), Expect = 4e-11 Identities = 35/95 (36%), Positives = 54/95 (56%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 + YP K P + FI++++HPNV SG +CLD++ WSP +D+ ++ + LL PN Sbjct: 61 EQYPNKPPQVKFISEMFHPNV-YASGELCLDILQNRWSPTYDVSSIL-TSVQSLLNDPNI 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPED 281 S P N EAA L R Y ++V+E + +D Sbjct: 119 SSPANVEAANLYKDHRSLYVKRVRETVENSWNDDD 153
>UB2L6_MOUSE (Q9QZU9) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 67.0 bits (162), Expect = 4e-11 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 1/97 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-NQTWSPMFDLVNVFEVFLPQ 407 VR++ P YP+K P++ F KIYHPNV E G VCL +I N+ W P V E L Sbjct: 52 VRIDFPREYPFKPPTLRFTTKIYHPNVRE-DGLVCLPLISNENWKPYTKPYQVLEA-LNV 109 Query: 406 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKY 296 L+ PN +P+ E A L+ ++ + +K +EF K+ Sbjct: 110 LVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLKF 146
>UBE2T_MOUSE (Q9CQ37) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 66.6 bits (161), Expect = 5e-11 Identities = 31/102 (30%), Positives = 58/102 (56%), Gaps = 4/102 (3%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI----NQTWSPMFDLVNVFEVF 416 + V +P+ YP++ P + F+ IYHPN+D SG +CLD++ W P ++ V Sbjct: 53 LEVIIPERYPFEPPQVRFLTPIYHPNIDS-SGRICLDILKLPPKGAWRPSLNIATVL-TS 110 Query: 415 LPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 + L+ PNP DPL + ++ ++ A+ +K K++ + +A+ Sbjct: 111 IQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAKQWTEAHAR 152
>UBC2_EMENI (Q96UP5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (UV sensitivity protein J) Length = 151 Score = 66.2 bits (160), Expect = 6e-11 Identities = 33/89 (37%), Positives = 53/89 (59%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 + YP K P + FI++++HPNV +G +CLD++ WSP +D+ + + LL PN Sbjct: 61 EQYPNKPPGVKFISQMFHPNV-YGTGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNT 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 S P N EA+ L +R Y ++V+E +K Sbjct: 119 SSPANVEASNLYRDNRKEYIKRVRETVEK 147
>UBC2_ASPFU (Q4WLA7) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) Length = 151 Score = 66.2 bits (160), Expect = 6e-11 Identities = 33/89 (37%), Positives = 53/89 (59%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 + YP K P + FI++++HPNV +G +CLD++ WSP +D+ + + LL PN Sbjct: 61 EQYPNKPPGVKFISQMFHPNV-YGTGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNT 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 S P N EA+ L +R Y ++V+E +K Sbjct: 119 SSPANVEASNLYKDNRKEYIKRVRETVEK 147
>UB2EC_SPISO (Q95044) Ubiquitin-conjugating enzyme E2-C (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 177 Score = 66.2 bits (160), Expect = 6e-11 Identities = 34/89 (38%), Positives = 53/89 (59%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 +E P YPYK P + F +HPNVD+ SG++CLD++ + W+ +D V + L LL Sbjct: 83 LEFPSDYPYKPPVVKFTTPCWHPNVDQ-SGNICLDILKENWTASYD-VRTILLSLQSLLG 140 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKE 311 PN + PLN +AA M ++ Y++ + E Sbjct: 141 EPNNASPLNAQAAD-MWSNQTEYKKVLHE 168
>UBE2T_XENLA (Q7ZY08) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 192 Score = 66.2 bits (160), Expect = 6e-11 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 4/107 (3%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI----NQTWSPMFDLVNVFEVF 416 + + +P+ YP++ P I F+ IYHPN+D +G +CLD++ W P ++ V Sbjct: 53 LEIIVPERYPFEPPKIRFLTPIYHPNIDS-AGRICLDILKLPPKGAWRPALNISTVL-TS 110 Query: 415 LPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPEDAG 275 + L+ PNP DPL + ++ +R + K++ +K+A P G Sbjct: 111 IQLLMSEPNPDDPLMADISSEFKYNRAVFFSNAKKWTEKHALPAPQG 157
>UB2L6_HUMAN (O14933) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 65.5 bits (158), Expect = 1e-10 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-NQTWSPMFDLVNVFEVFLPQ 407 +R+ P YP+K P I F KIYHPNVDE +G +CL +I ++ W P V E L Sbjct: 52 LRISFPPEYPFKPPMIKFTTKIYHPNVDE-NGQICLPIISSENWKPCTKTCQVLEA-LNV 109 Query: 406 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEF 308 L+ PN +PL + A L+ ++ + + +EF Sbjct: 110 LVNRPNIREPLRMDLADLLTQNPELFRKNAEEF 142
>UB12L_ARATH (Q9ZU75) Probable NEDD8-conjugating enzyme Ubc12-like (EC 6.3.2.-)| (RUB1-conjugating enzyme 2) (RUB1-protein ligase 2) (RUB1 carrier protein 2) Length = 185 Score = 65.5 bits (158), Expect = 1e-10 Identities = 30/87 (34%), Positives = 53/87 (60%) Frame = -1 Query: 574 ELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLY 395 ++ + YP+++P + K+YHPN+D + G+VCL+++ + W P+ + +N L L Sbjct: 84 QVSNMYPHEAPKVKCKTKVYHPNID-LEGNVCLNILREDWKPVLN-INTVIYGLFHLFTE 141 Query: 394 PNPSDPLNGEAAALMMRDRPAYEQKVK 314 PN DPLN EAAA++ + +E V+ Sbjct: 142 PNYEDPLNHEAAAVLRDNPKTFEYNVR 168
>UBC12_KLULA (Q6CSW8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/87 (35%), Positives = 54/87 (62%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 V + D YP + P + +++IYHPN+D + G+VCL+++ + W+P D+ ++ + + L Sbjct: 81 VFIKDTYPMEPPVVKCMHRIYHPNID-IDGNVCLNLLREDWTPALDIQSII-IGILFLFH 138 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKV 317 PN DPLN +AA ++ D +E KV Sbjct: 139 EPNGRDPLNKDAAKTLIEDPLRFENKV 165
>UBC2_TRIHA (Q58FS2) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/93 (34%), Positives = 54/93 (58%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 ++ + YP K P + FI++++HPNV +G +CLD++ WSP +D+ V + LL Sbjct: 57 MQFEEQYPNKPPQVKFISQMFHPNV-YANGELCLDILQNRWSPTYDVAAVL-TSIQSLLN 114 Query: 397 YPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 PN P N EA+ L +R Y ++V+E ++ Sbjct: 115 DPNTGSPANVEASNLYKDNRREYIKRVRETVER 147
>UBC1_MOUSE (P61087) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/97 (28%), Positives = 52/97 (53%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 + +++P+ YP+ P + FI KI+HPN+ ++G++CLD++ W+ L V + L L Sbjct: 57 LEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVL-LSLQAL 115 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L P DP + A ++ ++Q + + YA Sbjct: 116 LAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC1_HUMAN (P61086) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/97 (28%), Positives = 52/97 (53%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 + +++P+ YP+ P + FI KI+HPN+ ++G++CLD++ W+ L V + L L Sbjct: 57 LEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVL-LSLQAL 115 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L P DP + A ++ ++Q + + YA Sbjct: 116 LAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC1_BOVIN (P61085) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/97 (28%), Positives = 52/97 (53%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 + +++P+ YP+ P + FI KI+HPN+ ++G++CLD++ W+ L V + L L Sbjct: 57 LEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVL-LSLQAL 115 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L P DP + A ++ ++Q + + YA Sbjct: 116 LAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC12_ARATH (Q9SDY5) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme 1) (RUB1-protein ligase 1) (RUB1 carrier protein 1) Length = 184 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/87 (33%), Positives = 52/87 (59%) Frame = -1 Query: 574 ELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLY 395 ++ YP+++P + K+YHPN+D + G+VCL+++ + W P+ + +N L L Sbjct: 83 QVSPVYPHEAPKVKCKTKVYHPNID-LEGNVCLNILREDWKPVLN-INTVIYGLFHLFTE 140 Query: 394 PNPSDPLNGEAAALMMRDRPAYEQKVK 314 PN DPLN +AAA++ + +E V+ Sbjct: 141 PNSEDPLNHDAAAVLRDNPKLFETNVR 167
>UB2E2_MOUSE (Q91W82) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) Length = 201 Score = 63.5 bits (153), Expect = 4e-10 Identities = 32/92 (34%), Positives = 52/92 (56%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN 389 PD YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL N Sbjct: 112 PD-YPFKPPKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCN 168 Query: 388 PSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 P+DPL G A M +R +++ +++ +YA Sbjct: 169 PADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200
>UB2E2_HUMAN (Q96LR5) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) (UbcH8) Length = 201 Score = 63.5 bits (153), Expect = 4e-10 Identities = 32/92 (34%), Positives = 52/92 (56%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN 389 PD YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL N Sbjct: 112 PD-YPFKPPKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCN 168 Query: 388 PSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 P+DPL G A M +R +++ +++ +YA Sbjct: 169 PADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200
>UB2E1_MOUSE (P52482) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcM3) Length = 193 Score = 63.2 bits (152), Expect = 5e-10 Identities = 30/89 (33%), Positives = 50/89 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL NP+D Sbjct: 106 YPFKPPKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPAD 163 Query: 379 PLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PL G A M +R +++ +++ +YA Sbjct: 164 PLVGSIATQYMTNRAEHDRMARQWTKRYA 192
>UB2E1_HUMAN (P51965) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcH6) Length = 193 Score = 63.2 bits (152), Expect = 5e-10 Identities = 30/89 (33%), Positives = 50/89 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL NP+D Sbjct: 106 YPFKPPKVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVL-LSICSLLTDCNPAD 163 Query: 379 PLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PL G A M +R +++ +++ +YA Sbjct: 164 PLVGSIATQYMTNRAEHDRMARQWTKRYA 192
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 62.8 bits (151), Expect = 7e-10 Identities = 29/85 (34%), Positives = 50/85 (58%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 + YP K P + F++ ++HPNV +G +CLD++ WSP +D+ + + LL PN Sbjct: 61 EQYPNKPPLVKFVSTMFHPNV-YANGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNN 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVKE 311 + P N EAA L ++ Y ++V++ Sbjct: 119 ASPANAEAAQLHRENKKEYVRRVRK 143
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/84 (36%), Positives = 48/84 (57%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 + YP P + NKI+HPN+D G +CL+++ + WSP DL + L L PN Sbjct: 89 ETYPIDPPKVICNNKIFHPNIDP-HGKICLNILREDWSPALDL-QCIVLGLLSLFQEPNG 146 Query: 385 SDPLNGEAAALMMRDRPAYEQKVK 314 +DPLN EAA ++ +D+ + V+ Sbjct: 147 NDPLNKEAAEVLNKDKLEFGNLVR 170
>UBC84_DROME (P52487) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 153 Score = 61.2 bits (147), Expect = 2e-09 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 1/99 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNVFEVFLPQ 407 + + P YP+ P I F KIYHPNVDE G VCL +I+ W P V + L Sbjct: 53 IEINFPPQYPFMPPKILFKTKIYHPNVDE-KGEVCLPIISTDNWKPTTRTEQVLQA-LVA 110 Query: 406 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 ++ P P PL + A +R+ + + +EF K A+ Sbjct: 111 IVHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNAE 149
>UB2E3_MOUSE (P52483) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcM2) Length = 207 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/89 (32%), Positives = 50/89 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL NP+D Sbjct: 120 YPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTDCNPAD 177 Query: 379 PLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PL G A + +R +++ +++ +YA Sbjct: 178 PLVGSIATQYLTNRAEHDRIARQWTKRYA 206
>UB2E3_HUMAN (Q969T4) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcH9) (UbcM2) Length = 207 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/89 (32%), Positives = 50/89 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL NP+D Sbjct: 120 YPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTDCNPAD 177 Query: 379 PLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PL G A + +R +++ +++ +YA Sbjct: 178 PLVGSIATQYLTNRAEHDRIARQWTKRYA 206
>UBC2_NEUCR (P52493) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (Mutagen-sensitive protein 8) Length = 151 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/89 (34%), Positives = 50/89 (56%) Frame = -1 Query: 565 DAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP 386 + YP K PS+ FI++++HPNV +G +CLD++ WSP +D+ V + LL PN Sbjct: 61 EQYPNKPPSVKFISEMFHPNV-YATGELCLDILQNRWSPTYDVAAVL-TSIQSLLNDPNT 118 Query: 385 SDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 N + L +R Y ++V+E +K Sbjct: 119 GSRANVAPSNLYKDNRKEYHKRVRETVEK 147
>UBCD4_DROME (P52486) Ubiquitin-conjugating enzyme E2-22 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 199 Score = 60.8 bits (146), Expect = 3e-09 Identities = 27/97 (27%), Positives = 49/97 (50%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQL 404 + +++P+ YP+ P + FI +I+HPN+ ++G++CLD++ W+ L V + L L Sbjct: 58 LEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVL-LSLQAL 116 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 L P DP + A + K + + YA Sbjct: 117 LAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
>UBC16_SCHPO (Q9P6I1) Ubiquitin-conjugating enzyme E2 16 (EC 6.3.2.19)| (Ubiquitin-protein ligase 16) (Ubiquitin carrier protein 16) Length = 160 Score = 60.8 bits (146), Expect = 3e-09 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 1/97 (1%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLL 398 + + + YP PS+ F KI HPN+ +G VC+D++ WSP + L + + L Sbjct: 58 IHVHEGYPISPPSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSLQSACLAIISLLSN 117 Query: 397 YPNPSDPLNGEAAALMMR-DRPAYEQKVKEFCDKYAK 290 Y + S PLN +AA L+ D+ AY V+ YAK Sbjct: 118 Y-DASSPLNVDAAKLLRTGDKTAYNSLVRCTTYLYAK 153
>UBCD2_DROME (P52485) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 232 Score = 60.1 bits (144), Expect = 5e-09 Identities = 29/89 (32%), Positives = 50/89 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 YP+K P + F +IYH N++ G +CLD++ WSP + V + + LL NP+D Sbjct: 145 YPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTDCNPAD 202 Query: 379 PLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 PL G A +++R +++ + + +YA Sbjct: 203 PLVGSIATQYLQNREEHDRIARLWTKRYA 231
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 59.7 bits (143), Expect = 6e-09 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 2/100 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN--QTWSPMFDLVNVFEVFLP 410 + VE P+ YP K P + F YHPNV SG++CL ++N Q W P L + + + Sbjct: 60 ITVEYPNEYPSKPPKVKFPAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIV-LGVQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 LL PNP+ P A R++ Y++KV +Y+K Sbjct: 118 DLLDSPNPNSPAQEPAWRSFSRNKAEYDKKVLLQAKQYSK 157
>COP10_ARATH (Q9LJD7) Constitutive photomorphogenesis protein 10| Length = 182 Score = 58.9 bits (141), Expect = 1e-08 Identities = 29/93 (31%), Positives = 50/93 (53%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN 389 P YP+K P + F +IYH NVD +G + ++++ +WSP + V + + + L P Sbjct: 92 PSDYPFKPPKLVFKTRIYHCNVD-TAGDLSVNILRDSWSPALTITKVLQA-IRSIFLKPE 149 Query: 388 PSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAK 290 P P A L + DR +++ KE+ ++AK Sbjct: 150 PYSPALPVIARLYLTDREKHDEVAKEWTLRFAK 182
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 58.2 bits (139), Expect = 2e-08 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 2/99 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI--NQTWSPMFDLVNVFEVFLP 410 +R+ D +P P F ++HPNV SG+VCL ++ N+ W P + + + + Sbjct: 60 IRMLFKDDFPSTPPKCKFEPPLFHPNVYP-SGTVCLSLLDENKDWKPSISIKQLL-IGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 LL +PN DP EA + ++R YE++VK+ KYA Sbjct: 118 DLLNHPNIEDPAQAEAYQIYCQNRAEYEKRVKKEAVKYA 156
>UBC21_CAEEL (P52484) Probable ubiquitin-conjugating enzyme E2 21 (EC 6.3.2.19)| (Ubiquitin-protein ligase 21) (Ubiquitin carrier protein 21) Length = 260 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 15/100 (15%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIG---------------FINKIYHPNVDEMSGSVCLDVINQTWSP 449 ++V++P+ YP++ P + F+ +I+HPN+ +G++CLD++ W+ Sbjct: 72 IKVDIPEHYPFEPPKVTEIIFHIRAFEYIQAKFVTRIWHPNISSQTGTICLDILKDKWTA 131 Query: 448 MFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAY 329 L V + L +L P PSDP + A + + P + Sbjct: 132 SLTLRTVL-LSLQAMLCSPEPSDPQDAVVAKQFINNYPMF 170
>UBCX_PICAN (O60015) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 188 Score = 56.2 bits (134), Expect = 7e-08 Identities = 37/123 (30%), Positives = 56/123 (45%), Gaps = 23/123 (18%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFI----------------------NKIYHPNVDEMSGSVCLDV 470 + +++P YP P I F+ K+ HPNV+ +G +CLD+ Sbjct: 63 LEIDIPTNYPLDPPKIKFVVFGEEKIRQLQRKTSSGARKVCYKMPHPNVNFKTGEICLDI 122 Query: 469 INQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALM-MRDRPAYEQKVKEFCDKYA 293 + Q WSP + L + V + LL P P PLN + A L+ D AY+ V + KY+ Sbjct: 123 LQQKWSPAWTLQSAL-VAIVVLLANPEPLSPLNIDMANLLKCDDTTAYKDLVHYYIAKYS 181 Query: 292 KPE 284 E Sbjct: 182 AYE 184
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 53.9 bits (128), Expect = 3e-07 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNVFEVFLP 410 +R+ D YP P F ++HPNV SG+VCL ++ + W P + + + + Sbjct: 60 LRMLFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 +LL PN DP EA + ++R YE++V+ K+A Sbjct: 118 ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 53.9 bits (128), Expect = 3e-07 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNVFEVFLP 410 +R+ D YP P F ++HPNV SG+VCL ++ + W P + + + + Sbjct: 60 LRMLFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 +LL PN DP EA + ++R YE++V+ K+A Sbjct: 118 ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 53.9 bits (128), Expect = 3e-07 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNVFEVFLP 410 +R+ D YP P F ++HPNV SG+VCL ++ + W P + + + + Sbjct: 60 LRMLFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 +LL PN DP EA + ++R YE++V+ K+A Sbjct: 118 ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 53.9 bits (128), Expect = 3e-07 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNVFEVFLP 410 +R+ D YP P F ++HPNV SG+VCL ++ + W P + + + + Sbjct: 60 LRMLFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 +LL PN DP EA + ++R YE++V+ K+A Sbjct: 118 ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 53.9 bits (128), Expect = 3e-07 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNVFEVFLP 410 +R+ D YP P F ++HPNV SG+VCL ++ + W P + + + + Sbjct: 60 LRMLFKDDYPSSPPKCKFEPPLFHPNVYP-SGTVCLSILEEDKDWRPAITIKQIL-LGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYA 293 +LL PN DP EA + ++R YE++V+ K+A Sbjct: 118 ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 53.1 bits (126), Expect = 6e-07 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT--WSPMFDLVNVFEVFLPQLLLY 395 P+ YP + P F ++HPNV SG+VCL ++N+ W P + + + + LL Sbjct: 65 PEEYPTRPPKCRFTPPLFHPNV-YPSGTVCLSILNEEEGWKPAITIKQIL-LGIQDLLDD 122 Query: 394 PNPSDPLNGEAAALMMRDRPAYEQKVK 314 PN + P EA + +D+ YE++V+ Sbjct: 123 PNIASPAQTEAYTMFKKDKVEYEKRVR 149
>UBE2S_HUMAN (Q16763) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 222 Score = 52.0 bits (123), Expect = 1e-06 Identities = 25/82 (30%), Positives = 46/82 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 +P P F+ KI+HPNV +G +C++V+ + W+ + +V + + LL++PNP Sbjct: 70 FPASPPKGYFLTKIFHPNVG-ANGEICVNVLKRDWTAELGIRHVL-LTIKCLLIHPNPES 127 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 LN EA L++ + Y + + Sbjct: 128 ALNEEAGRLLLENYEEYAARAR 149
>UBE2S_MOUSE (Q921J4) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 223 Score = 52.0 bits (123), Expect = 1e-06 Identities = 25/82 (30%), Positives = 46/82 (56%) Frame = -1 Query: 559 YPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSD 380 +P P F+ KI+HPNV +G +C++V+ + W+ + +V + + LL++PNP Sbjct: 70 FPASPPKGYFLTKIFHPNVGP-NGEICVNVLKRDWTAELGIRHVL-LTIKCLLIHPNPES 127 Query: 379 PLNGEAAALMMRDRPAYEQKVK 314 LN EA L++ + Y + + Sbjct: 128 ALNEEAGRLLLENYEEYAARAR 149
>UBC12_CAEEL (Q9XVK5) NEDD8-conjugating enzyme ubc-12 (EC 6.3.2.-) (NEDD8| protein ligase) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 12) Length = 180 Score = 51.6 bits (122), Expect = 2e-06 Identities = 26/101 (25%), Positives = 53/101 (52%), Gaps = 6/101 (5%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQT------WSPMFDLVNVFEV 419 ++ +P Y P + + K++HPN++E GS+CL ++ Q W P +L +V Sbjct: 80 KITVPPEYNNVPPVVKCLTKVWHPNINE-DGSICLSILRQNSLDQYGWRPTRNLTDVVHG 138 Query: 418 FLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKY 296 + + +D LN +AA + ++R ++ +V+E+ +Y Sbjct: 139 LVSLFNDLMDFNDALNIQAAQMWSQNRESFNHRVREYISRY 179
>UBE2I_MESAU (O09181) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 51.6 bits (122), Expect = 2e-06 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 6/99 (6%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI--NQTWSPMFDLVNVFEVFLP 410 +R+ D YP P F ++HPNV SG+VCL ++ ++ W P + +F + + Sbjct: 60 LRMLFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLSILEEDKDWRPAITINQLF-IGIQ 117 Query: 409 QLLLYPNPSDPLNGEAAALMMRDRPAYEQK----VKEFC 305 +LL PN +P EA + ++R YE++ K+FC Sbjct: 118 ELLNEPNIQEPAQAEAYTIYCQNRVEYEKRFRAQAKKFC 156
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 50.8 bits (120), Expect = 3e-06 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 12/101 (11%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQ------------TWSPMFDL 437 ++ P+ +P+ P F IYHPNV G +C+ +++Q TWSP+ + Sbjct: 63 QMRFPEDFPFSPPQFRFTPAIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTV 121 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVK 314 +V + + LL PN + P N +AA ++ Y+Q+VK Sbjct: 122 ESVL-ISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVK 161
>UBCX_YEAST (P29340) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 183 Score = 50.4 bits (119), Expect = 4e-06 Identities = 30/95 (31%), Positives = 53/95 (55%), Gaps = 3/95 (3%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFI-NKIYHPNVDEMSGSVCLDVIN-QTWSPMFDLVNVFEVFLP 410 + +E+P +YP P I F+ N I H NV +G +CL+++ + W+P++DL++ + Sbjct: 80 ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA-VW 138 Query: 409 QLLLYPNPSDPLNGEAAALM-MRDRPAYEQKVKEF 308 +LL P PL+ + ++ D AY+ VK F Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYF 173
>UBC_ASFM2 (P25869) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 50.1 bits (118), Expect = 5e-06 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 13/107 (12%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN--------QTWSPMFDLVNVF 425 ++ P YPY+ P + F ++++HPN+ G +C+ +++ TWSP + V Sbjct: 53 KIVFPPKYPYEPPRLTFTSEMWHPNI-YSDGKLCISILHGDNAEEQGMTWSPAQKIDTVL 111 Query: 424 EVFLPQLLLYPNPSDPLNGEAAA-----LMMRDRPAYEQKVKEFCDK 299 + + LL PNP P N +AA L D +Y +VK+ K Sbjct: 112 -LSVISLLNEPNPDSPANVDAAKSYRKYLYKEDLESYPMEVKKTVKK 157
>UBC_ASFB7 (P27949) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 49.3 bits (116), Expect = 8e-06 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 16/116 (13%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN--------QTWSPMFDLVNVF 425 +V P YPY P + F ++++HPN+ G +C+ +++ TWSP ++ Sbjct: 53 KVAFPPEYPYAPPKLTFTSEMWHPNI-YPDGRLCISILHGDNAEEQGMTWSPA-QKIDTI 110 Query: 424 EVFLPQLLLYPNPSDPLNGEAAA-----LMMRDRPAYEQKVKEFCDK---YAKPED 281 + + LL PNP P N +AA + D +Y +VK+ K PED Sbjct: 111 LLSVISLLNEPNPDSPANVDAAKSYRKYVYKEDLESYPMEVKKTVKKSLDECSPED 166
>UBE2U_HUMAN (Q5VVX9) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 321 Score = 48.9 bits (115), Expect = 1e-05 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 2/92 (2%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN--QTWSPMFDLVNVFEVFLPQL 404 + Y Y P + FI +HPNVD +G C+D ++ + W+ + L ++ + L + Sbjct: 57 IHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSIL-LALQVM 115 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEF 308 L P +P+N EAA ++++D Y ++ F Sbjct: 116 LSNPVLENPVNLEAARILVKDESLYRTILRLF 147
>UBC7_CAEEL (P34477) Probable ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 48.9 bits (115), Expect = 1e-05 Identities = 26/102 (25%), Positives = 53/102 (51%), Gaps = 13/102 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDL 437 ++ P YP K P + FI++I+HPN+D+ G+VC+ +++ + W P+ + Sbjct: 57 LDFPRDYPQKPPKMKFISEIWHPNIDK-EGNVCISILHDPGDDKWGYERPEERWLPVHTV 115 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKE 311 + + + +L PN P N +AA + + +++KV + Sbjct: 116 ETIL-LSVISMLTDPNFESPANVDAAKMQRENYAEFKKKVAQ 156
>UBE2U_MACFA (Q95LM1) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 322 Score = 48.5 bits (114), Expect = 1e-05 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 2/92 (2%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN--QTWSPMFDLVNVFEVFLPQL 404 + Y Y P + F+ +HPNVD +G C+D ++ + W+ + L ++ + L + Sbjct: 57 IHFTSEYNYAPPVVKFVTIPFHPNVDPHTGQPCIDFLDNPKKWNTNYTLSSIL-LALQVM 115 Query: 403 LLYPNPSDPLNGEAAALMMRDRPAYEQKVKEF 308 L P +P+N EAA ++ +D Y +K F Sbjct: 116 LSNPVLENPVNLEAARILTKDESLYRTILKLF 147
>UBCX_PICPA (P49428) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 204 Score = 46.2 bits (108), Expect = 7e-05 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = -1 Query: 514 HPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALM-MRDR 338 HPN+ +G +CLD++ W+P + L + + LL P P PL+ + A LM + D Sbjct: 122 HPNIAFNTGEICLDILQAKWTPAWTLSSALTAIV-LLLNDPEPLSPLDIDMANLMKINDL 180 Query: 337 PAYEQKVKEFCDKYAKPEDAGI 272 AY ++ + +Y+ E+ I Sbjct: 181 KAYNSLIEYYVGRYSIEEEVYI 202
>UB2G1_RAT (P62255) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 46.2 bits (108), Expect = 7e-05 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 12/89 (13%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLP------- 410 P YP + P + FI +I+HPNVD+ +G VC+ ++++ + E +LP Sbjct: 61 PKDYPLRPPKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI 119 Query: 409 -----QLLLYPNPSDPLNGEAAALMMRDR 338 +L PN P N +AA DR Sbjct: 120 MISVISMLADPNGDSPANVDAAKEWREDR 148
>UB2G1_MOUSE (P62254) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 46.2 bits (108), Expect = 7e-05 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 12/89 (13%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLP------- 410 P YP + P + FI +I+HPNVD+ +G VC+ ++++ + E +LP Sbjct: 61 PKDYPLRPPKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI 119 Query: 409 -----QLLLYPNPSDPLNGEAAALMMRDR 338 +L PN P N +AA DR Sbjct: 120 MISVISMLADPNGDSPANVDAAKEWREDR 148
>UB2G1_HUMAN (P62253) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 46.2 bits (108), Expect = 7e-05 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 12/89 (13%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLP------- 410 P YP + P + FI +I+HPNVD+ +G VC+ ++++ + E +LP Sbjct: 61 PKDYPLRPPKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI 119 Query: 409 -----QLLLYPNPSDPLNGEAAALMMRDR 338 +L PN P N +AA DR Sbjct: 120 MISVISMLADPNGDSPANVDAAKEWREDR 148
>UB2R1_RABIT (Q29503) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 238 Score = 45.8 bits (107), Expect = 9e-05 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 13/113 (11%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDL 437 ++ P YPY P+ F+ K++HPN+ E +G VC+ ++ ++ W+P + Sbjct: 62 IKFPIDYPYSPPTFRFLTKMWHPNIYE-NGDVCISILHPPVDDPQSGELPSERWNPTQN- 119 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDKYAKPEDA 278 V + + LL PN P N +A+ + + R + + K KE+ + K A Sbjct: 120 VRTILLSVISLLNEPNTFSPANVDASVMFRKWRDS-KGKDKEYAEIIRKQVSA 171
>UB2R1_MOUSE (Q8CFI2) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 235 Score = 45.8 bits (107), Expect = 9e-05 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 13/106 (12%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFD 440 R++ P YPY P+ F+ K++HPN+ E +G VC+ ++ ++ W+P + Sbjct: 61 RLKFPIDYPYSPPAFRFLTKMWHPNIYE-TGDVCISILHPPVDDPQSGELPSERWNPTQN 119 Query: 439 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCD 302 V + + LL PN P N + A++M R + K +E+ D Sbjct: 120 -VRTILLSVISLLNEPNTFSPANVD-ASVMYRKWKESKGKDREYTD 163
>UB2R1_HUMAN (P49427) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 236 Score = 45.8 bits (107), Expect = 9e-05 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 13/106 (12%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFD 440 R++ P YPY P+ F+ K++HPN+ E +G VC+ ++ ++ W+P + Sbjct: 61 RLKFPIDYPYSPPAFRFLTKMWHPNIYE-TGDVCISILHPPVDDPQSGELPSERWNPTQN 119 Query: 439 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCD 302 V + + LL PN P N + A++M R + K +E+ D Sbjct: 120 -VRTILLSVISLLNEPNTFSPANVD-ASVMYRKWKESKGKDREYTD 163
>UBC7_YEAST (Q02159) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 165 Score = 45.1 bits (105), Expect = 2e-04 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 13/102 (12%) Frame = -1 Query: 580 RVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFD 440 ++E P YP P + F I HPN+ +G VC+ +++ + WSP+ Sbjct: 57 KLEFPKDYPLSPPKLTFTPSILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQS 115 Query: 439 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVK 314 + + + + +L PN N +A L +RP +E++VK Sbjct: 116 VEKIL-LSVMSMLSEPNIESGANIDACILWRDNRPEFERQVK 156
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 44.3 bits (103), Expect = 3e-04 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 13/100 (13%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDL 437 + P+ YP P++ F ++++HPNV G VC+ ++ ++ W+P+ + Sbjct: 59 MSFPENYPVSPPTVTFTSEMWHPNV-YSDGKVCISILHPPGDDPHGYELASERWTPVHTV 117 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKV 317 ++ + + +L PN P N EAA +R + +KV Sbjct: 118 ESIV-LSIISMLSGPNDESPANVEAAKEWRDNRAEFRKKV 156
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 43.5 bits (101), Expect = 4e-04 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 13/100 (13%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDL 437 + P YP P++ F + I+HPNV G VC+ ++ ++ W+P+ + Sbjct: 58 MSFPQNYPNSPPTVRFTSDIWHPNV-YPDGRVCISILHPPGDDPSGYELASERWTPVHTV 116 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKV 317 ++ + + +L PN P N EAA R +++KV Sbjct: 117 ESIM-LSIISMLSGPNDESPANVEAAKEWREKRDEFKKKV 155
>UBCY_ARATH (P42743) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42) Length = 161 Score = 42.4 bits (98), Expect = 0.001 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = -1 Query: 583 VRVELPDAYPYKSPSIGFINKI-YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQ 407 ++VE P+ YP ++P + F++ HP++ +G +CLD++ +WSP + +V L Sbjct: 65 LQVEFPEHYPMEAPQVVFVSPAPSHPHIYS-NGHICLDILYDSWSPAMTVNSVCISILSM 123 Query: 406 LLLYPNPSDPLNGE 365 L P P + + Sbjct: 124 LSSSPAKQRPADND 137
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 41.6 bits (96), Expect = 0.002 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 13/97 (13%) Frame = -1 Query: 568 PDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDLVNV 428 P YP P++ F + ++HPNV G VC+ ++ ++ W+P+ + ++ Sbjct: 61 PQNYPNSPPTVRFTSDMWHPNV-YSDGRVCISILHPPGDDPSGYELASERWTPVHTVESI 119 Query: 427 FEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKV 317 + + +L PN P N EAA R +++KV Sbjct: 120 M-LSIISMLSGPNDESPANVEAAKEWRDKRDEFKKKV 155
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 40.8 bits (94), Expect = 0.003 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 12/100 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCL------------DVINQTWSPMFDLV 434 + P YP P++ F ++++HPNV G VC+ ++ ++ W+P+ + Sbjct: 61 MSFPQNYPNSPPTVRFTSEMWHPNV-YPDGRVCISIHPPGDDPNGYELASERWTPVHTVE 119 Query: 433 NVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVK 314 ++ + + +L PN P N EAA + +++KV+ Sbjct: 120 SIV-LSIISMLSSPNDESPANIEAAKDWREKQDEFKKKVR 158
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 40.4 bits (93), Expect = 0.004 Identities = 24/100 (24%), Positives = 44/100 (44%), Gaps = 12/100 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLP---- 410 + P YP P + F +I+HPNV +G VC+ +++ + + E +LP Sbjct: 59 LSFPQDYPLMPPKMKFTTEIWHPNV-HPNGEVCISILHPPGDDKYGYEDAGERWLPVHSP 117 Query: 409 --------QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVK 314 +L PN P N +AA + ++++V+ Sbjct: 118 ETILISVISMLSSPNDESPANIDAAKEFRENPQEFKKRVR 157
>UBC7_SCHPO (O00102) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 166 Score = 40.0 bits (92), Expect = 0.005 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 13/106 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVI-------------NQTWSPMFDL 437 ++ P YP P++ F + +HPNV + G+VC+ ++ ++ WSP+ + Sbjct: 59 LKFPSDYPLGPPTLKFECEFFHPNVYK-DGTVCISILHAPGDDPNMYESSSERWSPVQSV 117 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 + + + +L PN N +A + DR Y + V+ K Sbjct: 118 EKIL-LSVMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARK 162
>UB2G2_PONPY (Q5RF84) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 37.0 bits (84), Expect = 0.041 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 13/106 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDL 437 + P YP P + F +++HPN+ G VC+ +++ + WSP+ + Sbjct: 58 LSFPLDYPLSPPKMRFTCEMFHPNI-YPDGRVCISILHAPGDDPMGYESSAERWSPVQSV 116 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 + + + +L PN N +A+ + DR + + K+ K Sbjct: 117 EKIL-LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UB2G2_MOUSE (P60605) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 37.0 bits (84), Expect = 0.041 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 13/106 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDL 437 + P YP P + F +++HPN+ G VC+ +++ + WSP+ + Sbjct: 58 LSFPLDYPLSPPKMRFTCEMFHPNI-YPDGRVCISILHAPGDDPMGYESSAERWSPVQSV 116 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 + + + +L PN N +A+ + DR + + K+ K Sbjct: 117 EKIL-LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UB2G2_HUMAN (P60604) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 37.0 bits (84), Expect = 0.041 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 13/106 (12%) Frame = -1 Query: 577 VELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVIN-------------QTWSPMFDL 437 + P YP P + F +++HPN+ G VC+ +++ + WSP+ + Sbjct: 58 LSFPLDYPLSPPKMRFTCEMFHPNI-YPDGRVCISILHAPGDDPMGYESSAERWSPVQSV 116 Query: 436 VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEFCDK 299 + + + +L PN N +A+ + DR + + K+ K Sbjct: 117 EKIL-LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>FTS1_HUMAN (Q9H8T0) Fused toes protein homolog (Ft1)| Length = 292 Score = 35.4 bits (80), Expect = 0.12 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = -1 Query: 577 VELPDAYPYKS-PSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLL 401 V +PD YP P + F ++HP VD SG + + W + + ++ ++ Sbjct: 126 VYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVF 185 Query: 400 LYPNPSDPLNGEAAALMMRDRPAYEQKV 317 + + PLN EAA L +D ++ KV Sbjct: 186 YKIDTASPLNPEAAVLYEKDIQLFKSKV 213
>FTS1_MOUSE (Q64362) Fused toes protein (FT1)| Length = 292 Score = 35.0 bits (79), Expect = 0.16 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = -1 Query: 577 VELPDAYPYKS-PSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLL 401 V +PD YP P + F ++HP VD SG + + W + + ++ ++ Sbjct: 126 VYIPDNYPDGDCPRLLFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVF 185 Query: 400 LYPNPSDPLNGEAAALMMRDRPAYEQKV 317 + + PLN EAA L +D ++ KV Sbjct: 186 YKIDTTSPLNPEAAVLYEKDIQLFKSKV 213
>UBE2W_BRARE (Q4VBH4) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 34.7 bits (78), Expect = 0.21 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 559 YPYKSPSIGFI--NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 428 YP++SP + F N HP+V +G +CL ++ + WSP + +V Sbjct: 64 YPFESPQVMFTGENIPVHPHVYS-NGHICLSILTEDWSPALSVQSV 108
>UBE2W_MOUSE (Q8VDW4) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 33.9 bits (76), Expect = 0.35 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -1 Query: 559 YPYKSPSIGFI--NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 428 YP+ SP + F N HP+V +G +CL ++ + WSP + +V Sbjct: 64 YPFDSPQVMFTGENIPIHPHVYS-NGHICLSILTEDWSPALSVQSV 108
>UBE2W_HUMAN (Q96B02) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 33.9 bits (76), Expect = 0.35 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -1 Query: 559 YPYKSPSIGFI--NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 428 YP+ SP + F N HP+V +G +CL ++ + WSP + +V Sbjct: 64 YPFDSPQVMFTGENIPVHPHVYS-NGHICLSILTEDWSPALSVQSV 108
>GLS1_YEAST (P38631) 1,3-beta-glucan synthase component GLS1 (EC 2.4.1.34)| (1,3-beta-D-glucan-UDP glucosyltransferase) (CND1 protein) (CWN53 protein) (FKS1 protein) (Papulacandin B sensitivity protein 1) Length = 1876 Score = 32.7 bits (73), Expect = 0.78 Identities = 17/68 (25%), Positives = 36/68 (52%) Frame = +2 Query: 59 WIRYKYTYLHDIQSSLSQIFWINLIANFATKIVYNGLWQ*LRIWFAHYILIAGVIFVFAK 238 W+R +YT S+ +FWI + +++ GLW+ + +F H + ++ + VFA Sbjct: 1354 WVR-RYTL------SIFIVFWIAFVPIVVQELIERGLWKATQRFFCHLLSLSPMFEVFAG 1406 Query: 239 LLFVTRLV 262 ++ + L+ Sbjct: 1407 QIYSSALL 1414
>GLS2_YEAST (P40989) 1,3-beta-glucan synthase component GLS2 (EC 2.4.1.34)| (1,3-beta-D-glucan-UDP glucosyltransferase) Length = 1895 Score = 32.3 bits (72), Expect = 1.0 Identities = 17/68 (25%), Positives = 36/68 (52%) Frame = +2 Query: 59 WIRYKYTYLHDIQSSLSQIFWINLIANFATKIVYNGLWQ*LRIWFAHYILIAGVIFVFAK 238 W+R +YT S+ +FWI + +++ GLW+ + +F H + ++ + VFA Sbjct: 1373 WVR-RYTL------SIFIVFWIAFVPIVVQELIERGLWKATQRFFRHILSLSPMFEVFAG 1425 Query: 239 LLFVTRLV 262 ++ + L+ Sbjct: 1426 QIYSSALL 1433 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,681,648 Number of Sequences: 219361 Number of extensions: 1602657 Number of successful extensions: 4475 Number of sequences better than 10.0: 154 Number of HSP's better than 10.0 without gapping: 4184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4283 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
