Clone Name | rbasd2c13 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU2M_COTJA (P24971) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 28 | 5.3 | 2 | KPC1_TRIRE (Q99014) Protein kinase C-like (EC 2.7.11.13) | 28 | 9.0 | 3 | NU2M_CHICK (P18937) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 28 | 9.0 |
---|
>NU2M_COTJA (P24971) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 346 Score = 28.5 bits (62), Expect = 5.3 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 36 HPTITIPPESLTHSLPFRIRPV-NRVTAMLT*IS 134 H TIT+PP S H +RI N TA+LT +S Sbjct: 299 HSTITLPPNSSNHMKLWRINTTPNTPTAILTVLS 332
>KPC1_TRIRE (Q99014) Protein kinase C-like (EC 2.7.11.13)| Length = 1139 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 6 SQLTECKSSAHPTITIPPESLTHSLPFRIRPVNRVTA 116 S +T+C S ++ E + H +P R +P + VTA Sbjct: 497 SVVTKCISKSNAETDPDEEKINHRIPHRFQPFSNVTA 533
>NU2M_CHICK (P18937) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 346 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 36 HPTITIPPESLTHSLPFRI-RPVNRVTAMLT*IS 134 H TIT+PP S H +R + +N TA+LT +S Sbjct: 299 HSTITLPPNSSNHMKLWRTNKTLNTPTAILTALS 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,844,278 Number of Sequences: 219361 Number of extensions: 244628 Number of successful extensions: 673 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)