| Clone Name | rbasd2b21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUTS_PROMM (Q7V978) DNA mismatch repair protein mutS | 30 | 8.0 |
|---|
>MUTS_PROMM (Q7V978) DNA mismatch repair protein mutS| Length = 927 Score = 30.0 bits (66), Expect = 8.0 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +3 Query: 348 DMKHRQTFLHFGKGRKLTDRTTIQMGTAIYISVNLGMIIGE--ASEFTDRTTTAFHFHNL 521 +M LH R L I GTA + +++ + E A++ RT A H+H L Sbjct: 784 EMAETANILHHASDRSLVLLDEIGRGTATFDGLSIAWAVSEHLATDLRSRTVFATHYHEL 843 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,867,053 Number of Sequences: 219361 Number of extensions: 2275595 Number of successful extensions: 4577 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4576 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 7902193040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)