Clone Name | rbasd2b15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1583_PASMU (Q9CKM8) Hypothetical protein PM1583 precursor | 30 | 2.0 | 2 | C11B1_RAT (P15393) Cytochrome P450 11B1, mitochondrial precursor... | 29 | 2.6 | 3 | RM04_YEAST (P36517) 60S ribosomal protein L4, mitochondrial prec... | 28 | 7.5 | 4 | YDA6_SCHPO (Q10348) Putative endonuclease C1F12.06c (EC 3.1.-.-) | 27 | 9.9 |
---|
>Y1583_PASMU (Q9CKM8) Hypothetical protein PM1583 precursor| Length = 204 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 185 EKLSYHCATKDIVINVRREYDL 250 E++S +C TKD +IN R YD+ Sbjct: 94 ERVSTNCKTKDTIINTRTRYDV 115
>C11B1_RAT (P15393) Cytochrome P450 11B1, mitochondrial precursor (EC| 1.14.15.4) (CYPXIB1) (P450C11) (Steroid 11-beta-hydroxylase) (P450(11 beta)-DS) Length = 499 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Frame = -3 Query: 265 HNXLPEIILTTHVDHNVLCSAMIGQFL------WTSTYVWNE 158 H+ PE + TH H++ S FL WTST VW E Sbjct: 214 HDLKPESVTFTHALHSMFKSTTQLMFLPKSLTRWTSTRVWKE 255
>RM04_YEAST (P36517) 60S ribosomal protein L4, mitochondrial precursor (YmL4)| (MRP-L4) Length = 319 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -3 Query: 310 IWLGCLGETSNMNNKHNXLPEIILTTHVDHNVLCSAMIGQFLWTSTYVWNE 158 +W CL E + + +++ L I+ +TH + + L S I +W +V NE Sbjct: 109 LWYNCLREQNVLARENHLLKNIVGSTHDEFSEL-SNSIRTTMWQIRHVLNE 158
>YDA6_SCHPO (Q10348) Putative endonuclease C1F12.06c (EC 3.1.-.-)| Length = 252 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Frame = -3 Query: 307 WLGCLGETSNMNNKHNXLPEIILTTHVDHNVL------CSAMIGQFLWTST 173 +L C+G T +++ L + +L DH +L S ++G +WTS+ Sbjct: 145 YLHCVGLTESLDAHRETLKKHVLKKTTDHPILIHSIDQSSEILGAAVWTSS 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,636,943 Number of Sequences: 219361 Number of extensions: 685356 Number of successful extensions: 903 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)