Clone Name | rbasd2a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CFTR_XENLA (P26363) Cystic fibrosis transmembrane conductance re... | 32 | 2.0 | 2 | UROM_HUMAN (P07911) Uromodulin precursor (Tamm-Horsfall urinary ... | 29 | 10.0 | 3 | UROM_PONPY (Q5R5C1) Uromodulin precursor | 29 | 10.0 |
---|
>CFTR_XENLA (P26363) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1485 Score = 31.6 bits (70), Expect = 2.0 Identities = 28/92 (30%), Positives = 42/92 (45%) Frame = -2 Query: 297 FIIQNLCTIAFITVPTCIAALYLILASCPAILVQNQKNTEEVLQPCMWCTLELIVLNACG 118 FI+ I F+ V A L++I + PAI + + +N EV TL +IV + Sbjct: 863 FILVFCLVIFFVEVAASSAWLWIIKRNAPAINMTSNENVSEVSD-----TLSVIVTHTSF 917 Query: 117 LYLRLIYVPKMNATSFFM*GLHKKLASVVXLV 22 Y+ IYV A S G+ + L V L+ Sbjct: 918 YYVFYIYVGV--ADSLLALGIFRGLPLVHSLI 947
>UROM_HUMAN (P07911) Uromodulin precursor (Tamm-Horsfall urinary glycoprotein)| (THP) Length = 640 Score = 29.3 bits (64), Expect = 10.0 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +1 Query: 433 LQICPVAFLHNHVWHLGLCRCVGG---PTRSCLPPLAATVCLDECPA-RTSSE 579 L +CP + WH C C G P C+P A VC D C A RT E Sbjct: 134 LCVCPAGY-RGDGWH---CECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDE 182
>UROM_PONPY (Q5R5C1) Uromodulin precursor| Length = 641 Score = 29.3 bits (64), Expect = 10.0 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +1 Query: 433 LQICPVAFLHNHVWHLGLCRCVGG---PTRSCLPPLAATVCLDECPA-RTSSE 579 L +CP + WH C C G P C+P A VC D C A RT E Sbjct: 134 LCVCPAGY-RGDGWH---CECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDE 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,776,796 Number of Sequences: 219361 Number of extensions: 1822992 Number of successful extensions: 4313 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4312 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)