Clone Name | rbasd1i06 |
---|---|
Clone Library Name | barley_pub |
>EXPB2_ARATH (Q9SHY6) Putative beta-expansin 2 precursor (AtEXPB2) (At-EXPB2)| (Ath-ExpBeta-1.4) Length = 273 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 274 GKTLVANKVIPAXWRPNTFXRSXVQY 197 GKT+VA+ VIPA W+P +S V + Sbjct: 248 GKTVVASNVIPANWQPGAIYKSNVNF 273
>EXB1A_MAIZE (P58738) Beta-expansin 1a precursor (Pollen allergen Zea m 1) (Zea| m I) Length = 269 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 274 GKTLVANKVIPAXWRPNTFXRSXVQY 197 GK ++A VIPA WRP+ S VQ+ Sbjct: 243 GKKVIAKDVIPANWRPDAVYTSNVQF 268
>EXB1B_MAIZE (Q07154) Beta-expansin 1b (Pollen allergen Zea m 1) (Zea m I)| (Fragment) Length = 191 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 274 GKTLVANKVIPAXWRPNTFXRSXVQY 197 GK ++A +IPA WRP+ S VQ+ Sbjct: 165 GKKVIAKDIIPANWRPDAVYTSNVQF 190
>MPAC1_CYNDA (O04701) Major pollen allergen Cyn d 1| Length = 246 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 274 GKTLVANKVIPAXWRPNTFXRSXVQY 197 G LV + VIPA W+P+T S +Q+ Sbjct: 219 GAHLVQDDVIPANWKPDTVYTSKLQF 244
>EXPB4_ARATH (Q9SHD1) Putative beta-expansin 4 precursor (AtEXPB4) (At-EXPB4)| (Ath-ExpBeta-1.1) Length = 259 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 271 KTLVANKVIPAXWRPNTFXRSXVQY 197 K +VA VIPA W+P+ RS V + Sbjct: 235 KVIVAYNVIPANWKPDESYRSIVNF 259
>YO86_CAEEL (P34622) Hypothetical protein ZK1236.6| Length = 206 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 24 QTFFSPSKDAPTPHTHPTRYSLQ 92 Q F SP + APT THP R S Q Sbjct: 64 QQFQSPQQQAPTQPTHPDRESYQ 86
>ZN575_HUMAN (Q86XF7) Zinc finger protein 575| Length = 245 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 4 HPXPHPTKPFSHLVKTHRH---HTPTQP 78 HP PH K F H K H H PT+P Sbjct: 119 HPCPHCPKSFGHRSKLAAHLWTHAPTRP 146
>ZN575_MACFA (Q9GM03) Zinc finger protein 575| Length = 260 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 4 HPXPHPTKPFSHLVKTHRH---HTPTQP 78 HP PH K F H K H H PT+P Sbjct: 134 HPCPHCPKAFGHRSKLAAHLWTHAPTRP 161
>MASZ_BACHD (Q9KB03) Malate synthase G (EC 2.3.3.9)| Length = 727 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 13 PHPTKPFSHLVKTHRHHTPTQPDTVYND 96 P PT H + HRHH P T+ +D Sbjct: 540 PSPTAATLHAIHYHRHHVPAIQKTLADD 567
>NOTC3_MOUSE (Q61982) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2318 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 124 CTVRPCVALSRCKLYLVGWVCGVGASLLGE 35 CT +PC C+ Y+ G+VC A G+ Sbjct: 1089 CTAQPCQHGGTCRGYMGGYVCECPAGYAGD 1118
>EXTN_MAIZE (P14918) Extensin precursor (Proline-rich glycoprotein)| Length = 267 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 6 PXPAPNQTFFSPSKDAPTPHTHPTRYSLQRLSATH 110 P P P ++PS PTP P Y+ TH Sbjct: 139 PTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPTH 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,158,210 Number of Sequences: 219361 Number of extensions: 455265 Number of successful extensions: 1602 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1602 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)