| Clone Name | rbasd1h24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DIAP2_MOUSE (O70566) Protein diaphanous homolog 2 (Diaphanous-re... | 31 | 2.5 | 2 | YEEJ_ECO57 (Q8X8V7) Hypothetical protein yeeJ | 30 | 3.3 |
|---|
>DIAP2_MOUSE (O70566) Protein diaphanous homolog 2 (Diaphanous-related formin-2)| (DRF2) (mDia3) Length = 1098 Score = 30.8 bits (68), Expect = 2.5 Identities = 19/65 (29%), Positives = 37/65 (56%) Frame = -2 Query: 538 SHTVQESPAVNSPSTVSENAVDKPPPAMSFNFEQEVQVNQKEIMDMYMKSMQQFTESLAK 359 S T +E P + S + AV + PPA+ + ++ + +++KE++D++ K M+ + K Sbjct: 57 SATKREKPVIQH-SIDYQTAVVEIPPALIVHDDRSLILSEKEVLDLFEKMMEDMNLNEEK 115 Query: 358 MKLPL 344 K PL Sbjct: 116 -KAPL 119
>YEEJ_ECO57 (Q8X8V7) Hypothetical protein yeeJ| Length = 2660 Score = 30.4 bits (67), Expect = 3.3 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = -2 Query: 529 VQESPAVNSPSTVSENAVDKPPPAMSFNFEQEVQVNQKEIMDMYMKSMQQFTESLAKM 356 V++ ++ P+ VSEN + PP S N EQ++ ++I + + M +E A M Sbjct: 109 VRQGDELDVPAQVSENNLTPPPGNSSGNLEQQIASTSQQIGSLLAEDMN--SEQAANM 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,458,240 Number of Sequences: 219361 Number of extensions: 774264 Number of successful extensions: 2424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2424 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)