Clone Name | rbasd1h17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EGR2_XENLA (Q08427) Early growth response protein 2 (EGR-2) (Kro... | 31 | 4.2 | 2 | RP1L1_MOUSE (Q8CGM2) Retinitis pigmentosa 1-like 1 protein (Reti... | 30 | 5.4 | 3 | E75_METEN (O77245) Nuclear hormone receptor E75 | 30 | 7.1 |
---|
>EGR2_XENLA (Q08427) Early growth response protein 2 (EGR-2) (Krox-20 protein)| Length = 421 Score = 30.8 bits (68), Expect = 4.2 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +1 Query: 187 KKNSELKLNMPFRSSFKTVTPKAH*SRTTLLNPAHGENQRRGYTLGPGRRHWPGTGP 357 K+++++ L R + T + H +RT+L P G +++ LGP HW P Sbjct: 362 KRHTKIHLRQKERKNSATAAWRQHVARTSL-KPQSGRDRQPCALLGPAAAHWDSIDP 417
>RP1L1_MOUSE (Q8CGM2) Retinitis pigmentosa 1-like 1 protein (Retinitis| pigmentosa 1-like protein 1) Length = 1859 Score = 30.4 bits (67), Expect = 5.4 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -2 Query: 424 GLRAGEVQGQNARKLVYVPSHGEDQSQASGACPDPECS 311 G R EV G+ +L VP H Q A P P C+ Sbjct: 609 GTRGWEVSGEPELRLALVPGHSGSQDTQRDALPAPACA 646
>E75_METEN (O77245) Nuclear hormone receptor E75| Length = 606 Score = 30.0 bits (66), Expect = 7.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 255 SLKPHNPPQPSSWRESKTRLHS 320 SL PH+PP P SW LHS Sbjct: 564 SLTPHSPPPPRSWSRRCLSLHS 585 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,671,492 Number of Sequences: 219361 Number of extensions: 2365856 Number of successful extensions: 5572 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5572 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)