Clone Name | rbasd1g19 |
---|---|
Clone Library Name | barley_pub |
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 2.0 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 423 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 530 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 2.0 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 423 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 530 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 31.2 bits (69), Expect = 2.7 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -3 Query: 186 GEVVTRFP*VNLRKDHCRDPDQN-RP-CSRHPIXRRW 82 G + ++FP NL+K++CR+PD+ RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRW 254
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.8 bits (68), Expect = 3.5 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -3 Query: 186 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPIXRRW 82 G + ++FP NL+K++CR+PD + RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRW 254
>TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnormal gonad| development protein 2) Length = 2032 Score = 30.0 bits (66), Expect = 6.0 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +2 Query: 236 RTAPVAAIRTLHRTIQSVGATGGVYKGQGRSQRELMTRA 352 RTAP+ R HR +S TGGVY +G R L+ A Sbjct: 124 RTAPIKKTRK-HRRRRSGSFTGGVYPRKGHRNRSLLGHA 161
>BCL9_DROME (Q961D9) Bcl-9 homolog (Protein legless)| Length = 1469 Score = 29.6 bits (65), Expect = 7.8 Identities = 29/103 (28%), Positives = 43/103 (41%) Frame = +1 Query: 241 RPRRRDPNTSPDHSIGRSDGRCVQRAGT*STRADDSRLLGIPR*RPTIAMIYPHHDEISQ 420 RP + P P HSI RS + T S L +P R T A++ + S Sbjct: 758 RPLQGPP--PPYHSIQRSASVPI---ATQSPNPSSPNNLSLPSPRTTAAVMGLPTNSPSM 812 Query: 421 DYPGLSAKAIYSLNTSV*RACGPEHLRASQTCYCLKLPSPKRR 549 D G + ++ NTS +A L A++ C+ PSP + Sbjct: 813 DGTGSLSGSVPQANTSTVQAGTTTVLSANKNCFQADTPSPSNQ 855 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,999,904 Number of Sequences: 219361 Number of extensions: 1699373 Number of successful extensions: 3392 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3392 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)