Clone Name | rbasd1g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YMFN_ECOLI (P75978) Hypothetical protein ymfN | 32 | 1.5 | 2 | ENVE_SALTY (Q56030) Probable lipoprotein envE precursor | 30 | 5.6 | 3 | DXS_PSESM (Q889Q1) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2... | 30 | 7.3 |
---|
>YMFN_ECOLI (P75978) Hypothetical protein ymfN| Length = 455 Score = 32.0 bits (71), Expect = 1.5 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = -2 Query: 510 VW*ICSPSGLFLGS*VLLTRYNPDTLDESVLW----TESRDVGAGYRCIR 373 VW C+ SG+ L S ++ R + DE V W T +R +GAG +R Sbjct: 9 VWDGCAASGMKLSSVAIMARLADFSNDEGVCWPSIETIARQIGAGMSTVR 58
>ENVE_SALTY (Q56030) Probable lipoprotein envE precursor| Length = 173 Score = 30.0 bits (66), Expect = 5.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 315 GVRDGTTLILWEWTEGDNQRW 253 G ++GT +IL+ T DNQRW Sbjct: 108 GTKEGTPIILYSCTGNDNQRW 128
>DXS_PSESM (Q889Q1) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 631 Score = 29.6 bits (65), Expect = 7.3 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -2 Query: 153 KDGVDVSGVSVLFEELYIHIYVDELVMVVLLA*IMCDGCMSKPVLVI 13 K+G D+ S F E Y + + E V L A + C+G SKPV+ I Sbjct: 355 KEGSDLVDFSERFPERYFDVAIAEQHAVTLAAGMACEG--SKPVVAI 399 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,782,302 Number of Sequences: 219361 Number of extensions: 1968107 Number of successful extensions: 4265 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4265 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)