| Clone Name | rbasd1g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLMS_BUCBP (P59499) Glucosamine--fructose-6-phosphate aminotrans... | 28 | 4.3 | 2 | PRB4S_HUMAN (P10163) Basic salivary proline-rich protein 4 allel... | 28 | 7.4 | 3 | GSPC1_ERWCH (P31698) General secretion pathway protein C (Pectic... | 27 | 9.7 |
|---|
>GLMS_BUCBP (P59499) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 609 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 312 NVQRQMETNGHTEHYFKGVIY*SPNA-KNFI 223 N+Q T GH +HY K IY P A KN I Sbjct: 239 NIQNDSITKGHYQHYMKKEIYEQPYAIKNAI 269
>PRB4S_HUMAN (P10163) Basic salivary proline-rich protein 4 allele S precursor| (Salivary proline-rich protein Po) (Parotid o protein) [Contains: Protein N1; Glycosylated protein A] Length = 247 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 Query: 210 ESXFLVENKPRFIIPQGGNKSESENHPSQTFQG 112 ES FL+ KP PQGGN+ + P QG Sbjct: 27 ESLFLISGKPEGRRPQGGNQPQRPPPPPGKPQG 59
>GSPC1_ERWCH (P31698) General secretion pathway protein C (Pectic enzymes| secretion protein outC) Length = 272 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = -1 Query: 284 ATLNITLRGLFIKVRMLKTLXPILR-NPXF*WKINPDLLYPKAATSQNPKIIHXRPSKVV 108 +TLN++L G+ + +++ I + N F +N ++ N KI+ RP KVV Sbjct: 91 STLNLSLTGVMVGDDTARSIAIISKDNEQFSRGVNEEV------PGYNAKIVSIRPDKVV 144 Query: 107 YKSMGEVAIL 78 + G +L Sbjct: 145 LQYQGRYEVL 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,116,282 Number of Sequences: 219361 Number of extensions: 820453 Number of successful extensions: 1380 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1380 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)