ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd1e22 |
|---|---|
| Clone Library Name | barley_pub |
>PYRG_HUMAN (P17812) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 591 Score = 89.7 bits (221), Expect = 7e-18 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQLD 455 E GL+FVG+D G+RMEI+E+ DHPFF+GVQ+HPEF S P KPSP + GL+ A+ G+L Sbjct: 493 EEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLS 552 Query: 454 QVLQDSC 434 LQ C Sbjct: 553 HYLQKGC 559
>PYRG_MOUSE (P70698) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 591 Score = 89.4 bits (220), Expect = 9e-18 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQLD 455 E GL+FVG+D G+RMEI+E+ DHPFF+GVQ+HPEF S P KPSP + GL+ A+ G+L Sbjct: 493 EEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLP 552 Query: 454 QVLQDSC 434 LQ C Sbjct: 553 HYLQKGC 559
>PYRG_SCHPO (O42644) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 600 Score = 89.0 bits (219), Expect = 1e-17 Identities = 41/71 (57%), Positives = 52/71 (73%), Gaps = 4/71 (5%) Frame = -1 Query: 643 PAF----ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIA 476 PAF E G+ F+GKDE G+RMEIIE DHP+F+GVQ+HPE+ S P KPSP GL+A Sbjct: 492 PAFVSRLEQGGISFIGKDERGERMEIIEKRDHPYFVGVQYHPEYLSKPLKPSPPIFGLVA 551 Query: 475 AACGQLDQVLQ 443 A+ G LD+ +Q Sbjct: 552 ASAGLLDEFIQ 562
>PYRG_NEUCR (Q7RZV2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 568 Score = 85.1 bits (209), Expect = 2e-16 Identities = 35/71 (49%), Positives = 53/71 (74%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D + E +GL F+GKD++G+RME++EI DHP+++GVQ+HPE+ S PS F+G +AA Sbjct: 481 DYIEKLEQSGLIFIGKDDSGERMEVVEIKDHPYYVGVQYHPEYTSRVLDPSRPFLGFVAA 540 Query: 472 ACGQLDQVLQD 440 A G LDQ+ ++ Sbjct: 541 AIGCLDQITKE 551
>PYRG_METKA (Q8TYT7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 79.3 bits (194), Expect = 9e-15 Identities = 38/62 (61%), Positives = 44/62 (70%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAAC 467 V E+ GL+F G G RME +E+PDHP+F+G QFHPEFKS P PSP FVGLI AA Sbjct: 472 VRELEDHGLRFSGHSPDG-RMEALELPDHPYFVGTQFHPEFKSRPGDPSPPFVGLIKAAA 530 Query: 466 GQ 461 GQ Sbjct: 531 GQ 532
>URA7_YEAST (P28274) CTP synthase 1 (EC 6.3.4.2) (UTP--ammonia ligase 1) (CTP| synthetase 1) Length = 579 Score = 77.8 bits (190), Expect = 3e-14 Identities = 35/69 (50%), Positives = 49/69 (71%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 MV EN GL FVGKD+TG+R EI+E+ +HP++I Q+HPE+ S PS F+GL+AA+ Sbjct: 497 MVDELENNGLIFVGKDDTGKRCEILELKNHPYYIATQYHPEYTSKVLDPSKPFLGLVAAS 556 Query: 469 CGQLDQVLQ 443 G L V++ Sbjct: 557 AGILQDVIE 565
>PYRG_CANGA (Q6FUD0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 578 Score = 76.3 bits (186), Expect = 8e-14 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 + + E GL FVG+DET +R EI E+ DHPFF+ Q+HPE+ S PS F+GL+AA Sbjct: 496 NFIERLEEHGLMFVGRDETNKRCEIFEMKDHPFFVATQYHPEYTSKVLDPSKPFLGLVAA 555 Query: 472 ACGQLDQVL 446 + G LD V+ Sbjct: 556 SSGILDDVI 564
>PYRG_GIBZE (O74638) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 580 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 6/81 (7%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D + E AGL D+ G R+E IE+ DHPFF+G+Q HPE+KS P+P +GL+AA Sbjct: 493 DYIEDLEKAGLSLTSMDDQGVRVETIELKDHPFFVGLQAHPEYKSKTLAPAPSLLGLVAA 552 Query: 472 ACGQLDQVL------QDSCNG 428 + G LD+++ Q S NG Sbjct: 553 SSGCLDEIIEAAHKKQSSSNG 573
>PYRG_ASHGO (Q751L7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 576 Score = 74.7 bits (182), Expect = 2e-13 Identities = 34/68 (50%), Positives = 46/68 (67%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 MV E GL+FVG+DETG R EI+E+ DHP+++ Q+HPE+ S PS F+GL+AAA Sbjct: 497 MVQKLEEHGLKFVGRDETGTRCEILELVDHPYYVATQYHPEYMSKVLDPSQPFLGLVAAA 556 Query: 469 CGQLDQVL 446 L +L Sbjct: 557 ANILPSLL 564
>PYRG_ARCFU (O29987) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 532 Score = 74.7 bits (182), Expect = 2e-13 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 + + E+ GL F + G+RMEI E+PDHPFF QFHPEFKS P +PSP FVG + A Sbjct: 463 EYIEKIESKGLVFSAYSDGGRRMEIAELPDHPFFFATQFHPEFKSRPYRPSPPFVGFVRA 522 Query: 472 A 470 A Sbjct: 523 A 523
>PYRG_PYRAB (Q9V1S2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 72.4 bits (176), Expect = 1e-12 Identities = 35/62 (56%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = -1 Query: 652 DMVPAFENAGLQFVG-KDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIA 476 D + AFE AGL F G + +RMEI+E+PD +FI QFHPEFKS P KP+P+F GL+ Sbjct: 465 DYIEAFEKAGLVFSGIAGDDERRMEILELPDKRYFIATQFHPEFKSRPMKPAPVFHGLVK 524 Query: 475 AA 470 AA Sbjct: 525 AA 526
>PYRG_PYRAE (Q8ZSY7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 530 Score = 72.4 bits (176), Expect = 1e-12 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +P F AGL G +R+EIIE+P HP+FI QFHPEFKS P+KP P+F+GL+ AA Sbjct: 467 LPKFTEAGLVVSGWRRDIKRVEIIELPGHPYFIATQFHPEFKSRPAKPRPVFLGLLKAA 525
>PYRG_SYNEL (Q8DKT7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 543 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 F G Q G G+ +EIIE P HPFFI VQFHPEF+S P+ P PLF GL+AAA Sbjct: 473 FLETGYQITGTSPDGRLVEIIEYPAHPFFIAVQFHPEFRSRPNAPHPLFYGLLAAA 528
>PYRG_PYRHO (O59456) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = -1 Query: 652 DMVPAFENAGLQFVG-KDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIA 476 D + AFE AGL F G + +RMEI+E+PD +FI QFHPEFKS P +P+P+F GL+ Sbjct: 465 DYIEAFEKAGLVFSGVAGDDERRMEILELPDKRYFIATQFHPEFKSRPMRPAPVFHGLVR 524 Query: 475 AA 470 AA Sbjct: 525 AA 526
>PYRG_PYRKO (Q5JGF1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 533 Score = 70.9 bits (172), Expect = 3e-12 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -1 Query: 652 DMVPAFENAGLQFVG-KDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIA 476 D V FE AGL F G + +RMEI+E+P H +FI QFHPEFKS P +P+P+F GL+ Sbjct: 465 DYVEKFEEAGLVFSGIAGDDERRMEILELPGHSYFIATQFHPEFKSRPMRPAPVFRGLVE 524 Query: 475 AA 470 AA Sbjct: 525 AA 526
>PYRG_RHOBA (Q7UJ86) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 551 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -1 Query: 640 AFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQ 461 AFE+AG++F G G +EI+EI HP+F+ QFHPEFKS P K PLF I AA + Sbjct: 473 AFEDAGMRFTGLSPDGGLVEIVEIDSHPWFVAAQFHPEFKSKPLKSHPLFTDFIEAAINR 532 Query: 460 LDQ 452 Q Sbjct: 533 RKQ 535
>PYRG_HAEDU (Q7VNV5) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/60 (51%), Positives = 40/60 (66%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++P E AGL+ G + +EIIE+P+HP+FI QFHPEF STP PLF G +AAA Sbjct: 477 LLPTIEAAGLKVSGVSADRKLVEIIEVPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVAAA 536
>PYRG_AZOBR (P28595) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 67.4 bits (163), Expect = 4e-11 Identities = 35/58 (60%), Positives = 37/58 (63%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQ 461 E GL F G T Q EI+EIPDHP+FIGVQFHPE KS P P PLF I AA Q Sbjct: 484 EKVGLLFSGLSPT-QLPEIVEIPDHPWFIGVQFHPELKSKPFDPHPLFTSFIKAAIEQ 540
>PYRG_PSESM (Q886M5) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 543 Score = 67.4 bits (163), Expect = 4e-11 Identities = 29/64 (45%), Positives = 40/64 (62%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 +++P AGL+ G+ G +E++E PDHP+F+ QFHPEF STP PLF G + A Sbjct: 475 NLLPQLIEAGLKISGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVKA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 ALAQ 538
>PYRG_CAUCR (Q9A7K3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 550 Score = 67.4 bits (163), Expect = 4e-11 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 V E+AGL+ G+ G EI+E DHP+FIGVQ+HPE KS P P PLF IAAA Sbjct: 485 VHLMEDAGLKLTGRSPNGVLPEIVERDDHPWFIGVQYHPELKSRPFAPHPLFASFIAAA 543
>PYRG_HALSA (Q9HP32) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 553 Score = 67.0 bits (162), Expect = 5e-11 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = -1 Query: 625 GLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQLD 455 GL F G E G RMEI+E DHPFF G QFHPE++S P++ SP FVGL+ A + D Sbjct: 485 GLTFSG--EAGNRMEIVEHDDHPFFFGTQFHPEYRSRPTRASPPFVGLLDAVLERAD 539
>PYRG_BACSU (P13242) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 67.0 bits (162), Expect = 5e-11 Identities = 30/61 (49%), Positives = 39/61 (63%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQLD 455 E G F G G+ +EIIE+ DHP+F+ QFHPEFKS P++P PLF G I A+ + Sbjct: 474 EEQGFVFSGTSPDGRLVEIIELKDHPWFVASQFHPEFKSRPTRPQPLFKGFIGASVEAAN 533 Query: 454 Q 452 Q Sbjct: 534 Q 534
>PYRG_SHIFL (P0A7E8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 67.0 bits (162), Expect = 5e-11 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E+AGL+ G+ Q +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_ECOLI (P0A7E5) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 67.0 bits (162), Expect = 5e-11 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E+AGL+ G+ Q +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_ECOL6 (P0A7E6) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 67.0 bits (162), Expect = 5e-11 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E+AGL+ G+ Q +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_ECO57 (P0A7E7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 67.0 bits (162), Expect = 5e-11 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E+AGL+ G+ Q +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_PYRFU (Q8TZY6) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 67.0 bits (162), Expect = 5e-11 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -1 Query: 646 VPAFENAGLQFVG-KDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 + A E AGL F G + +RMEI+E+PD +FI QFHPEFKS P +P+P+F GL+ AA Sbjct: 467 IEALEKAGLVFSGVAGDDERRMEILELPDKRYFIATQFHPEFKSRPMRPAPVFHGLVRAA 526
>PYRG_PSEAE (Q9HXZ4) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 67.0 bits (162), Expect = 5e-11 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 +++P E AGL+ G+ G +E++E P+HP+F+ QFHPEF STP PLF G + A Sbjct: 475 NLLPQLEQAGLKISGRSGDGALVEVVEAPEHPWFVACQFHPEFTSTPRDGHPLFSGFVNA 534 Query: 472 A 470 A Sbjct: 535 A 535
>URA8_YEAST (P38627) CTP synthase 2 (EC 6.3.4.2) (UTP--ammonia ligase 2) (CTP| synthetase 2) Length = 577 Score = 66.6 bits (161), Expect = 6e-11 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIA 476 +V E+ G FVGKDETGQR EI E+ HP+++G Q+HPE+ S +PS F GL+A Sbjct: 499 IVNDMESRGFIFVGKDETGQRCEIFELKGHPYYVGTQYHPEYTSKVLEPSRPFWGLVA 556
>PYRG_ENCCU (Q8SQI7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 66.6 bits (161), Expect = 6e-11 Identities = 25/52 (48%), Positives = 38/52 (73%) Frame = -1 Query: 625 GLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 G++FVG G+++ + E+ HPFF+GVQFHPEF + P +P PL GL++A+ Sbjct: 479 GVRFVGFSSGGKKINVFEVESHPFFVGVQFHPEFNARPDRPHPLITGLVSAS 530
>PYRG_YERPE (Q8ZBN1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 66.6 bits (161), Expect = 6e-11 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E AGL+ G+ + +EIIE+PDHP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEAAGLRVAGRSADNKLVEIIELPDHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_HAEIN (P44341) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 66.6 bits (161), Expect = 6e-11 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++P E AGL+ G + +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 477 LLPQIEKAGLKVTGLSADKKLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 536
>PYRG_RHILO (Q98MF0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 66.2 bits (160), Expect = 8e-11 Identities = 32/64 (50%), Positives = 36/64 (56%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D E+ GL F G G E +E PDHP+FIGVQ+HPE KS P P PLF I A Sbjct: 475 DYKERLEDCGLVFAGMSPDGVLPETVEYPDHPWFIGVQYHPELKSRPLDPHPLFASFIEA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 AVEQ 538
>PYRG_SALTY (P65921) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E AGL+ G+ Q +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEAAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_SALTI (P65922) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/60 (48%), Positives = 39/60 (65%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E AGL+ G+ Q +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 476 LLKQIEAAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_METAC (Q8TKW5) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 65.9 bits (159), Expect = 1e-10 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 + V E+ G+ F GK++ RMEI EIPD FF QFHPEF+S P +PSP F GL+ A Sbjct: 466 EFVDRLESFGIVFSGKNKN--RMEIAEIPDKRFFFASQFHPEFRSRPGRPSPPFKGLVRA 523 Query: 472 AC 467 C Sbjct: 524 MC 525
>PYRG_CLOPE (Q8XIB3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 65.5 bits (158), Expect = 1e-10 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -1 Query: 628 AGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +GL G G+ +E +E+ DHP+F+ VQ+HPE KS P++P PLFVG + AA Sbjct: 479 SGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAA 531
>PYRG_PSEPK (Q88MG1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 65.5 bits (158), Expect = 1e-10 Identities = 29/64 (45%), Positives = 39/64 (60%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 +++P AGL G+ E G +E++E DHP+F+ QFHPEF STP PLF G + A Sbjct: 475 NLLPQLVEAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 ALAQ 538
>PYRG_RHIME (Q92QA0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 65.1 bits (157), Expect = 2e-10 Identities = 33/64 (51%), Positives = 36/64 (56%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D E+ GL F G G E IE PDHP+FIGVQ+HPE KS P P PLF I A Sbjct: 475 DYKSRLESCGLVFSGMSPDGVLPETIEYPDHPWFIGVQYHPELKSRPLDPHPLFSSFIEA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 ALEQ 538
>PYRG_PASMU (Q9CJW9) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/58 (50%), Positives = 37/58 (63%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E AGL+ G + +EIIE+P+HP+F+ QFHPEF STP PLF G + AA Sbjct: 479 PQVEKAGLKVTGLSADKKLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 536
>PYRG_BRUSU (Q8G0G1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/64 (50%), Positives = 36/64 (56%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D E AGL F G G E +E DHP+FIGVQ+HPE KS P +P PLF I A Sbjct: 475 DYKDRLEAAGLNFAGMSPDGVLPETVEYADHPWFIGVQYHPELKSRPFEPHPLFASFIEA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 AIEQ 538
>PYRG_BRUME (Q8YHF2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/64 (50%), Positives = 36/64 (56%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D E AGL F G G E +E DHP+FIGVQ+HPE KS P +P PLF I A Sbjct: 475 DYKDRLEAAGLNFAGMSPDGVLPETVEYADHPWFIGVQYHPELKSRPFEPHPLFASFIEA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 AIEQ 538
>PYRG_AGRT5 (Q8UEY5) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/64 (48%), Positives = 35/64 (54%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D E GL F G G E +E PDHP+FIGVQ+HPE KS P P PLF + A Sbjct: 475 DYKDRLEECGLVFSGMSPDGVLPETVEYPDHPWFIGVQYHPELKSRPLDPHPLFASFVEA 534 Query: 472 ACGQ 461 A Q Sbjct: 535 AVEQ 538
>PYRG_ANASP (Q8YMD4) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = -1 Query: 631 NAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQ 461 ++G G G+ +EI+E P HPFFI QFHPEF+S P+ P PLF G + AA Q Sbjct: 475 DSGYVISGTSPDGRLVEIVEYPQHPFFISCQFHPEFQSRPNTPHPLFTGFVQAAIAQ 531
>PYRG_METMA (Q8Q0L8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 64.3 bits (155), Expect = 3e-10 Identities = 32/62 (51%), Positives = 39/62 (62%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 + V E+ G+ F GK++ RMEI EIP FF QFHPEFKS P +PSP F GL+ A Sbjct: 466 EFVDRLESFGIVFSGKNKN--RMEIAEIPGKRFFFASQFHPEFKSRPGRPSPPFKGLVRA 523 Query: 472 AC 467 C Sbjct: 524 MC 525
>PYRG_SYNP7 (Q54775) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 546 Score = 63.9 bits (154), Expect = 4e-10 Identities = 31/58 (53%), Positives = 35/58 (60%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACG 464 F +G G +EI+E PDHPFFI QFHPEF S P+ P PLF GLI AA G Sbjct: 473 FLESGYCVSGTSPDSHLVEIVERPDHPFFIACQFHPEFVSRPNHPHPLFQGLIKAALG 530
>PYRG_SYNY3 (P74208) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 552 Score = 63.9 bits (154), Expect = 4e-10 Identities = 31/78 (39%), Positives = 42/78 (53%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQL 458 F + G G G+ +EI+E P HPFFI QFHPEF S P++ PLF G I A + Sbjct: 473 FTDTGFVVSGTSPDGRLVEIVEYPHHPFFIACQFHPEFHSRPNQAHPLFSGFINAVLKRR 532 Query: 457 DQVLQDSCNGHVVVAKHK 404 + + + N H V H+ Sbjct: 533 NAPAKIAVNCHTVTEDHE 550
>PYRG_CLOAB (Q97F61) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 63.2 bits (152), Expect = 7e-10 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -1 Query: 625 GLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAAC 467 GL G + +EI+EI DHP+F+GVQFHPEFKS P++P LF I AC Sbjct: 478 GLILAGTSPDDRLVEIVEIKDHPWFVGVQFHPEFKSRPNRPHALFRDFIKVAC 530
>PYRG_METJA (Q58574) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 540 Score = 62.8 bits (151), Expect = 9e-10 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQ 461 EN GL GK G+ E IEI + +FI Q HPEFKS P+KP PLF GL+ A+ G+ Sbjct: 480 ENHGLTISGKSPDGRLAEFIEISKNRYFIATQAHPEFKSRPNKPHPLFDGLVRASLGE 537
>PYRG_BUCAP (P59039) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 553 Score = 62.4 bits (150), Expect = 1e-09 Identities = 29/60 (48%), Positives = 38/60 (63%) Frame = -1 Query: 649 MVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 ++ E GL+ G+ + +EIIEI DHP+FIG QFHPEF STP PLF+ I +A Sbjct: 479 LLKKIEKNGLKIAGRSKKNNIVEIIEIFDHPWFIGCQFHPEFTSTPRDGHPLFIDFIKSA 538
>PYRG_BACAN (Q81JW1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 62.4 bits (150), Expect = 1e-09 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E AG F G G+ +EIIE+ DHP+F+ QFHPE S P++P PLF + A+ Sbjct: 471 PDMEKAGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVKAS 528
>PYRG_LEPIN (Q8F3J3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +E G+ G +EI+EIP H +FIGVQFHPEF+S P+ P PLF G I A+ Sbjct: 480 YEENGMIIAGTSPDDNLVEIVEIPKHNWFIGVQFHPEFQSKPTLPHPLFAGFIRAS 535
>PYRG_LEPIC (Q72S46) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +E G+ G +EI+EIP H +FIGVQFHPEF+S P+ P PLF G I A+ Sbjct: 480 YEENGMIIAGTSPDDNLVEIVEIPKHNWFIGVQFHPEFQSKPTLPHPLFAGFIRAS 535
>PYRG_BACHD (Q9K6D7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 532 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G F G G+ +EI+E+ DHPFFI QFHPEF S P++P PLF I A+ Sbjct: 475 EAKGFMFSGTSPDGRLVEIVELGDHPFFIASQFHPEFVSRPTRPQPLFREFIQAS 529
>PYRG_VIBCH (Q9KPC4) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E AGL+ G + +E+IE P HP+F+ QFHPEF STP PLF G + AA Sbjct: 478 PQIEKAGLKVSGLSADKKLVEVIENPAHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 535
>PYRG_MYCCC (Q93DW6) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) (Fragment) Length = 99 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 E+ GL+F G E +E+IEIP FF+ QFHPEF S P+KP+PLF G I A Sbjct: 40 ESVGLRFSGIYEEKNLVEVIEIPSLKFFVASQFHPEFTSRPNKPTPLFKGFIKA 93
>PYRG_VIBVY (Q7MHQ0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/58 (50%), Positives = 36/58 (62%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E AGL+ G + +E+IE P+HP+F+ QFHPEF STP PLF G I AA Sbjct: 479 PQIEKAGLKVSGLSADKKLVEMIENPNHPWFVAAQFHPEFTSTPRDGHPLFSGFIKAA 536
>PYRG_VIBVU (Q8DC63) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/58 (50%), Positives = 36/58 (62%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E AGL+ G + +E+IE P+HP+F+ QFHPEF STP PLF G I AA Sbjct: 479 PQIEKAGLKVSGLSADKKLVEMIENPNHPWFVAAQFHPEFTSTPRDGHPLFSGFIKAA 536
>PYRG_CHLPN (Q9Z8U8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 60.8 bits (146), Expect = 3e-09 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D + + E+ GL+ VG EIIE+ DHP+ IGVQFHPEF S P PLF+ I A Sbjct: 467 DYIQSLEDHGLRIVGTCPPQGLCEIIEVSDHPWMIGVQFHPEFVSKLISPHPLFIAFIEA 526 Query: 472 A 470 A Sbjct: 527 A 527
>PYRG_NITEU (O85347) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 564 Score = 60.5 bits (145), Expect = 4e-09 Identities = 33/79 (41%), Positives = 42/79 (53%), Gaps = 5/79 (6%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIP--DHPFFIGVQFHPEFKSTPSKPSPLFVGLI 479 + +P E AG+ G G E+IE+P +HP+F+ QFHPEF STP PLF I Sbjct: 475 EFIPQLEQAGMHISGLSAEGDLCEMIELPQSEHPWFVACQFHPEFTSTPRNGHPLFKSYI 534 Query: 478 AAA---CGQLDQVLQDSCN 431 AA GQ D+ S N Sbjct: 535 QAAISFAGQSDRTKLHSRN 553
>PYRG_BACCR (Q814T2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 60.5 bits (145), Expect = 4e-09 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E G F G G+ +EIIE+ DHP+F+ QFHPE S P++P PLF + A+ Sbjct: 471 PDMEKEGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>PYRG_VIBPA (Q87LP9) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 546 Score = 60.5 bits (145), Expect = 4e-09 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P E AGL+ G + +E+IE P HP+F+ QFHPEF STP PLF G + AA Sbjct: 479 PQIEKAGLKVSGLSADKKLVEMIENPAHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>PYRG_BUCAI (P57491) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 60.5 bits (145), Expect = 4e-09 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E AGLQ G+ + +EIIE+ +HP+F+ QFHPEF STP PLF+ I +A Sbjct: 483 EAAGLQVTGRSQKNNVVEIIELSNHPWFLACQFHPEFTSTPRDGHPLFIDFIKSA 537
>PYRG_STAES (Q8CNI2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 60.1 bits (144), Expect = 6e-09 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+ G+ F G G+ +EIIEIP + FFI QFHPEF S P++P P+F + AA Sbjct: 475 ESNGMVFSGTSPDGRLVEIIEIPKNDFFIACQFHPEFLSRPNRPQPIFKSFVEAA 529
>PYRG_STAEQ (Q5HM95) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 60.1 bits (144), Expect = 6e-09 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+ G+ F G G+ +EIIEIP + FFI QFHPEF S P++P P+F + AA Sbjct: 475 ESNGMVFSGTSPDGRLVEIIEIPKNDFFIACQFHPEFLSRPNRPQPIFKSFVEAA 529
>PYRG_SULTO (Q976E9) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 531 Score = 60.1 bits (144), Expect = 6e-09 Identities = 28/63 (44%), Positives = 40/63 (63%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 + V + GL G E G +E+IE+ +H FF+G+Q HPE+KS P PSP+F+G + A Sbjct: 469 EYVDLLQKGGLVISGVSENGL-VEMIELKNHKFFLGLQGHPEYKSRPLAPSPVFIGFLRA 527 Query: 472 ACG 464 A G Sbjct: 528 AAG 530
>PYRG_MYCCT (Q48965) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 532 Score = 60.1 bits (144), Expect = 6e-09 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 E+ GL+F G E +E+IE+P FF+ QFHPEF S P+KP+PLF G I A Sbjct: 473 ESVGLRFSGIYEEKNLVEVIEMPSLKFFVASQFHPEFTSRPNKPTPLFKGFIKA 526
>PYRG_CHLTR (Q59321) CTP synthase (EC 6.3.4.2) (CTP synthase) (UTP--ammonia| ligase) Length = 539 Score = 59.7 bits (143), Expect = 7e-09 Identities = 28/59 (47%), Positives = 37/59 (62%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 + E GL+ G G+ EI+EIP+H + +GVQFHPEF S +KP PLF+ I AA Sbjct: 468 IERLEEHGLKIAGVCPLGELCEIVEIPNHRWMLGVQFHPEFLSKLAKPHPLFIEFIRAA 526
>PYRG_SULSO (Q980S6) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 59.3 bits (142), Expect = 1e-08 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 V E+AGL G E G +EIIE+P + FF+ Q HPEFKS P+ PSP+++G I A Sbjct: 475 VDILEDAGLVVSGISENGL-VEIIELPSNKFFVATQAHPEFKSRPTNPSPIYLGFIRA 531
>PYRG_RICPR (Q9ZDF1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 586 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 FE G+ F G + Q +EIIE+P+ +F+GVQFHPEFKS P + PLF+ I A Sbjct: 521 FEQHGVVFSGFSQNKQIVEIIELPELRWFVGVQFHPEFKSKPFEAHPLFIQFIKA 575
>PYRG_SPICI (P52200) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 58.9 bits (141), Expect = 1e-08 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -1 Query: 628 AGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 AGL F G +E+IEIP +PF++ Q+HPEF S P+KP+PLF G + A Sbjct: 479 AGLVFSGLYVEKNLVEVIEIPKYPFYLAAQYHPEFTSRPNKPNPLFNGFVQA 530
>PYRG_TREPA (O83327) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 577 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQL 458 FE + L+ VG D +E++E +HP+F GVQFHPEF S P++ PLF L+AA + Sbjct: 514 FEASALRPVGVDSDCGAVEVVEHGEHPWFFGVQFHPEFCSRPNRAHPLFRALVAAGLERK 573 Query: 457 D 455 D Sbjct: 574 D 574
>PYRG_NEIMB (Q9JYJ8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 58.5 bits (140), Expect = 2e-08 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRM-EIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 VP E AGL G +R+ E IE+P+HP+F QFHPEF S P K PLF + AA Sbjct: 479 VPTLEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>PYRG_NEIMA (Q9JTK1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 58.5 bits (140), Expect = 2e-08 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRM-EIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 VP E AGL G +R+ E IE+P+HP+F QFHPEF S P K PLF + AA Sbjct: 479 VPTLEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>PYRG_METTH (O26519) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 533 Score = 58.5 bits (140), Expect = 2e-08 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+ GL G +E++EI DHP+F+G QFHPEF+S P++ PLFV + AA Sbjct: 474 ESKGLIISGTSPDDFLVEMVEIKDHPWFLGCQFHPEFRSRPNRAHPLFVSFLRAA 528
>PYRG_CHLMU (Q9PKL0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 58.2 bits (139), Expect = 2e-08 Identities = 29/59 (49%), Positives = 37/59 (62%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 V + GL+ VG G EIIEIP+H + +GVQFHPEF S + P PLFV ++AA Sbjct: 468 VDLLQKNGLRIVGVCPQGDLCEIIEIPNHRWMLGVQFHPEFLSKLAAPHPLFVKFLSAA 526
>PYRG_STAHJ (Q4L808) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 57.4 bits (137), Expect = 4e-08 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ F G G+ +E++EIP++ F+I QFHPEF S P++P P+F + AA Sbjct: 475 EANGMVFSGTSPDGRLVEMVEIPENDFYIACQFHPEFLSRPNRPQPIFKSFVEAA 529
>PYRG_BUCBP (P59577) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 57.4 bits (137), Expect = 4e-08 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E GL+ GK + + +EIIE+ +H +FI QFHPEF STP PLF+ I AA Sbjct: 481 EKYGLKITGKSKKNKLVEIIELSNHLWFIACQFHPEFTSTPRDGHPLFIDFIKAA 535
>PYRG_CHLCV (Q822T2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 57.4 bits (137), Expect = 4e-08 Identities = 28/61 (45%), Positives = 36/61 (59%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D + ++ GL VG+ EI+E +HP+ +GVQFHPEF S P PLFVG I A Sbjct: 467 DYIQQLKDHGLNIVGRCPQQGLCEIVETENHPWMVGVQFHPEFLSKLITPHPLFVGFIQA 526 Query: 472 A 470 A Sbjct: 527 A 527
>PYRG_MYCTU (P0A5U2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 586 Score = 57.4 bits (137), Expect = 4e-08 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 628 AGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +GL+F G G +E +E P HPF +G Q HPE KS P++P PLFV + AA Sbjct: 491 SGLRFSGTSPDGHLVEFVEYPPDRHPFVVGTQAHPELKSRPTRPHPLFVAFVGAA 545
>PYRG_MYCBO (P0A5U3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 586 Score = 57.4 bits (137), Expect = 4e-08 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 628 AGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +GL+F G G +E +E P HPF +G Q HPE KS P++P PLFV + AA Sbjct: 491 SGLRFSGTSPDGHLVEFVEYPPDRHPFVVGTQAHPELKSRPTRPHPLFVAFVGAA 545
>PYRG_RICCN (Q92I97) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 57.0 bits (136), Expect = 5e-08 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE G+ F G + + +EIIE+P +F+GVQFHPEFKS P + PLF+ I AA Sbjct: 475 FEKHGIVFSGFSKDEEIVEIIELPLLRWFVGVQFHPEFKSKPFEAHPLFIQFIKAA 530
>PYRG_HELPY (O25116) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 538 Score = 57.0 bits (136), Expect = 5e-08 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +EN GL+ VG + +E IE+ DHPFF+GVQFHPEF S P+P+ + I +A Sbjct: 480 WENKGLKVVGFG-SNHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFIKSA 534
>PYRG_DEIRA (Q9RU23) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 56.6 bits (135), Expect = 6e-08 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -1 Query: 586 MEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +E +EI DHPFF+ +Q HPEFKS P +PSP F G + AA Sbjct: 500 VETVEIADHPFFVALQAHPEFKSRPMRPSPPFAGFVKAA 538
>PYRG_CHLTE (P59040) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 565 Score = 56.6 bits (135), Expect = 6e-08 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE G+ F G G +EI+E+ +H +F+ VQFHPE KS K PLF G + AA Sbjct: 482 FEEKGMIFSGTSPNGDLVEIVELKNHRWFVAVQFHPELKSRVQKVHPLFDGFVHAA 537
>PYRG_HELPJ (Q9ZM99) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 538 Score = 56.6 bits (135), Expect = 6e-08 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +EN GL+ VG +E IE+ DHPFF+GVQFHPEF S P+P+ + I +A Sbjct: 480 WENKGLKVVGFG-ANHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFIKSA 534
>PYRG_STAS1 (Q49Z73) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 56.6 bits (135), Expect = 6e-08 Identities = 24/55 (43%), Positives = 35/55 (63%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ F G G+ +E++EIP + FF+ QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVFSGTSPDGRLVEMVEIPSNDFFVACQFHPEFLSRPNRPQPIFKAFIEAS 529
>PYRG_MYCPU (Q98PQ3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 539 Score = 55.8 bits (133), Expect = 1e-07 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLI 479 + E+ F G G+ EI E+ +HPF++GVQ+HPEF S P KP+PLF + Sbjct: 477 IDLLEDEEFVFSGIWNEGKLAEICEVKNHPFYLGVQYHPEFTSRPLKPNPLFTSFL 532
>PYRG_THETN (Q8R720) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 55.8 bits (133), Expect = 1e-07 Identities = 25/51 (49%), Positives = 31/51 (60%) Frame = -1 Query: 625 GLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 GL G + +EIIE+ DHP+F+ QFHPEFKS P P PLF + A Sbjct: 477 GLVISGLSPDERLVEIIELKDHPYFVATQFHPEFKSRPLNPHPLFRDFVKA 527
>PYRG_STRR6 (Q8DQY0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 55.5 bits (132), Expect = 1e-07 Identities = 23/56 (41%), Positives = 34/56 (60%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE AG F G + +EI+EIP++ FF+ Q+HPE S P++P L+ + AA Sbjct: 475 FEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>PYRG_STRPN (Q97S93) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 55.5 bits (132), Expect = 1e-07 Identities = 23/56 (41%), Positives = 34/56 (60%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE AG F G + +EI+EIP++ FF+ Q+HPE S P++P L+ + AA Sbjct: 475 FEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>PYRG_OCEIH (Q8EM53) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 55.5 bits (132), Expect = 1e-07 Identities = 24/52 (46%), Positives = 32/52 (61%) Frame = -1 Query: 625 GLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 G F G G+ +E IE+ DHP+F+ QFHPEF S P++ LF G I A+ Sbjct: 478 GFVFSGTSPDGRLVETIEVKDHPWFVACQFHPEFTSRPTRAQSLFKGFIGAS 529
>PYRG_AQUAE (O67353) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 531 Score = 55.1 bits (131), Expect = 2e-07 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 FE+ G+ F G + +EI+E+ +H +++G QFHPEFKS P P PLF I A Sbjct: 468 FESKGVVFSGTSPDDKLVEIMELKNHMWYLGCQFHPEFKSKPFAPHPLFRDFIRA 522
>PYRG_STRCO (Q9S224) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 549 Score = 54.3 bits (129), Expect = 3e-07 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 + AG+ F G G+ +E +E P HP+ + Q HPE +S P++P PLF GL+ AA Sbjct: 486 KKAGIVFSGTSPDGKLVEYVEYPRDVHPYLVATQAHPELRSRPTRPHPLFAGLVKAA 542
>PYRG_MYCLE (P53529) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 590 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = -1 Query: 628 AGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +GL+ G G +E +E P HPF +G Q HPE KS P++P PLFV + AA Sbjct: 491 SGLRISGTSPDGYLVEFVEYPANMHPFVVGTQAHPELKSRPTRPHPLFVAFVGAA 545
>PYRG_XANAC (Q8PLS3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 554 Score = 54.3 bits (129), Expect = 3e-07 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIP--DHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+AGL GK +E++E+P HP+F+ Q HPEF STP PLF+G + AA Sbjct: 483 EDAGLVISGKSMDDTLVEVVELPRDTHPWFLACQAHPEFLSTPRDGHPLFIGFVRAA 539
>PYRG_LISMF (Q71WM0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 532 Score = 54.3 bits (129), Expect = 3e-07 Identities = 22/55 (40%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E AG+ G+ +E++E+ DHP+F+ Q+HPEF S P++P LF + AA Sbjct: 474 EEAGMIVSATSPDGRLVEVVELADHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 528
>PYRG_LISIN (Q927T4) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 532 Score = 54.3 bits (129), Expect = 3e-07 Identities = 22/55 (40%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E AG+ G+ +E++E+ DHP+F+ Q+HPEF S P++P LF + AA Sbjct: 474 EEAGMIVSATSPDGRLVEVVELADHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 528
>PYRG_THEAC (Q9HM27) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 54.3 bits (129), Expect = 3e-07 Identities = 27/61 (44%), Positives = 34/61 (55%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D + E AG +F DE G RMEI+E P FI Q+H EFKS P PS + + L+ Sbjct: 461 DYIDMIEKAGFKFSATDEEGIRMEILERPGDESFIATQYHSEFKSRPLDPSKVHLHLVEQ 520 Query: 472 A 470 A Sbjct: 521 A 521
>PYRG_STRP6 (Q5XA10) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 53.9 bits (128), Expect = 4e-07 Identities = 22/58 (37%), Positives = 34/58 (58%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P FE AG F G + +EI+E+ + FF+ Q+HPE +S P++P L+ + AA Sbjct: 472 PEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAA 529
>PYRG_STRP3 (P65926) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 53.9 bits (128), Expect = 4e-07 Identities = 22/58 (37%), Positives = 34/58 (58%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P FE AG F G + +EI+E+ + FF+ Q+HPE +S P++P L+ + AA Sbjct: 472 PEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAA 529
>PYRG_STRP1 (P65925) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 53.9 bits (128), Expect = 4e-07 Identities = 22/58 (37%), Positives = 34/58 (58%) Frame = -1 Query: 643 PAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 P FE AG F G + +EI+E+ + FF+ Q+HPE +S P++P L+ + AA Sbjct: 472 PEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAA 529
>PYRG_XANCP (Q8P9Z6) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 554 Score = 53.9 bits (128), Expect = 4e-07 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIP--DHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+AGL GK +E++E+P HP+F+ Q HPEF STP PLF+G + AA Sbjct: 483 EDAGLVICGKSMDDTLVEMVELPRDTHPWFLACQAHPEFLSTPRDGHPLFIGFVRAA 539
>PYRG_STAAW (P65924) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ G G+ +E++EIP + FFI QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEAS 529
>PYRG_STAAS (Q6G7I3) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ G G+ +E++EIP + FFI QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEAS 529
>PYRG_STAAR (Q6GEU8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ G G+ +E++EIP + FFI QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEAS 529
>PYRG_STAAN (P99072) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ G G+ +E++EIP + FFI QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEAS 529
>PYRG_STAAM (P65923) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ G G+ +E++EIP + FFI QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEAS 529
>PYRG_STAAC (Q5HE73) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 536 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E G+ G G+ +E++EIP + FFI QFHPEF S P++P P+F I A+ Sbjct: 475 EANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEAS 529
>PYRG_WIGBR (Q8D2K0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 552 Score = 53.5 bits (127), Expect = 5e-07 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -1 Query: 586 MEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +EIIE +HP+F+G QFHPEF STP PLF+ + AA Sbjct: 506 VEIIEYSNHPWFVGSQFHPEFNSTPRNSHPLFISFVKAA 544
>PYRG_RALSO (Q8Y0B8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 554 Score = 53.5 bits (127), Expect = 5e-07 Identities = 26/61 (42%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 VP E +G+ + + E++E+P HP+F+GVQFHPEF STP PLF + A Sbjct: 481 VPQLEKSGMIISARTPSENLPEMMELPGAMHPWFVGVQFHPEFTSTPRDGHPLFKAYVEA 540 Query: 472 A 470 A Sbjct: 541 A 541
>PYRG_LISMO (Q8Y495) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 532 Score = 53.5 bits (127), Expect = 5e-07 Identities = 22/55 (40%), Positives = 34/55 (61%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E AG+ G+ +E++E+ DHP+F+ Q+HPEF S P++P LF + AA Sbjct: 474 EEAGMIVSATSPDGRLVEVVELIDHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 528
>PYRG_SULAC (Q4JAK8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 529 Score = 53.5 bits (127), Expect = 5e-07 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 + V + G+ G E G +EIIE+ +H FF+G Q HPE+KS P PSP+F+ ++ Sbjct: 468 EYVDLLQKYGMIISGVSENGL-VEIIELKNHKFFLGTQAHPEYKSRPLSPSPVFLNFLSV 526 Query: 472 A 470 A Sbjct: 527 A 527
>PYRG_THEMA (Q9WZR0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 524 Score = 52.8 bits (125), Expect = 9e-07 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = -1 Query: 586 MEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGL 482 +E +E+ DHPFF+GVQFHPE+KS P P+FV L Sbjct: 482 IEAVELEDHPFFVGVQFHPEYKSKVGAPHPIFVYL 516
>PYRG_XYLFA (Q9PDU1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 554 Score = 52.0 bits (123), Expect = 2e-06 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+AGL K +E+IE+P HP+F+ Q HPEF STP PLF+G + AA Sbjct: 483 EDAGLVIAAKSMDDTLVEMIELPREMHPWFLACQAHPEFLSTPRDGHPLFIGFVKAA 539
>PYRG_STRP8 (Q8NZF8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 51.6 bits (122), Expect = 2e-06 Identities = 21/56 (37%), Positives = 33/56 (58%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE AG F G + +EI+E+ + FF+ Q+HPE +S P++P L+ + AA Sbjct: 474 FEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAA 529
>PYRG_LACLA (Q9CI75) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 51.2 bits (121), Expect = 3e-06 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE AG F G + +EI+E+ D FF+ Q+HPE +S P++P L+ I A Sbjct: 475 FEKAGFVFSGVSPDNRLVEIVELSDKKFFVACQYHPELQSRPNRPEELYTEFIRVA 530
>PYRG_XYLFT (Q87DY8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 554 Score = 50.8 bits (120), Expect = 3e-06 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E+AGL K +E+IE+P HP+F+ Q HPEF STP PLF+G + A+ Sbjct: 483 EDAGLVIAAKSMDDTLVEMIELPREMHPWFLACQAHPEFLSTPRDGHPLFIGFVKAS 539
>PYRG_THEVO (Q97CR8) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 540 Score = 50.4 bits (119), Expect = 4e-06 Identities = 26/59 (44%), Positives = 32/59 (54%) Frame = -1 Query: 646 VPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 + E AG F G DE G RMEI+E FI Q+H EFKS P PS + + L+ A Sbjct: 463 ISIIEKAGFVFSGTDEDGIRMEILEKKGDESFIATQYHSEFKSRPLNPSRVHLHLVQQA 521
>PYRG_AERPE (Q9YBJ4) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 538 Score = 50.1 bits (118), Expect = 6e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 565 DHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 DHPFF+ QFHPEFKS P P+P+F G + A Sbjct: 502 DHPFFLATQFHPEFKSRPLNPAPVFKGFVTA 532
>PYRG_LACPL (Q88Z76) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 49.3 bits (116), Expect = 1e-05 Identities = 22/52 (42%), Positives = 31/52 (59%) Frame = -1 Query: 625 GLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 G+ F G + +E+IE+P FF+ Q+HPEF S P++P LF I AA Sbjct: 478 GMVFSGTSPDNRLVEVIELPKKRFFVASQYHPEFLSRPNRPEGLFKAFIDAA 529
>PYRG_CORGL (Q8NQL7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 554 Score = 49.3 bits (116), Expect = 1e-05 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPD--HPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 E + L F G G +E +E P HP+ + Q HPE+KS P+ PLF GL+ A Sbjct: 491 EGSDLVFSGTSPDGHLVEFVEYPKEVHPYLVATQAHPEYKSRPTHAHPLFYGLVKTA 547
>PYRG_LACLC (O87761) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 48.5 bits (114), Expect = 2e-05 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 FE AG F G + +EI+E+ FF+ Q+HPE +S P++P L+ I A Sbjct: 475 FEKAGFVFSGVSPDNRLVEIVELSGKKFFVACQYHPELQSRPNRPEELYTEFIRVA 530
>PYRG_BORBU (O51522) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 533 Score = 47.0 bits (110), Expect = 5e-05 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = -1 Query: 652 DMVPAFENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAA 473 D + F GL G + ++IEIP++ FF+ QFHPE + P+ LF+GLI A Sbjct: 472 DYIDLFAKNGLIVSGFSSDFKMAKLIEIPENKFFVACQFHPELITRIENPAKLFLGLIKA 531
>PYRG_CAMJE (Q9PJ84) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 543 Score = 43.9 bits (102), Expect = 4e-04 Identities = 25/61 (40%), Positives = 32/61 (52%) Frame = -1 Query: 637 FENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQL 458 FE GL G E+ +E +E+ HPFF+ VQFHPEF S +P+ I AA Sbjct: 484 FEKYGLIVSG--ESKGLIEAVELNCHPFFLAVQFHPEFTSRLEHVNPVICSFIKAAINYE 541 Query: 457 D 455 D Sbjct: 542 D 542
>PYRG_FIBSU (Q939R0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) (Fragment) Length = 133 Score = 41.6 bits (96), Expect = 0.002 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = -1 Query: 634 ENAGLQFVGKDETGQRMEIIEIPDHPFFIGVQFHPE 527 E AGL+ G G+ +E++E+ +HP+F QFHPE Sbjct: 98 EKAGLKIAGTSPDGKLVEMVELKNHPYFEACQFHPE 133
>PUUD_ECOLI (P76038) Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.-)| (gamma-Glu-GABA hydrolase) Length = 254 Score = 34.3 bits (77), Expect = 0.33 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -1 Query: 586 MEIIEIPDHPFFIGVQFHPEFKSTPSKPSP-LFVGLIAA 473 +E + + +HPF +GVQ+HPE+ S+ S LF G I A Sbjct: 205 VEAVSVINHPFALGVQWHPEWNSSEYALSRILFEGFITA 243
>PYRG_UREPA (Q9PQK7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 33.5 bits (75), Expect = 0.56 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -1 Query: 586 MEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLI 479 ++++E + F++ F+PE+ S PSK +P F+ L+ Sbjct: 498 IDVLEYTKNHFYVLTIFNPEYTSKPSKANPYFINLL 533
>IE18_PRVKA (P33479) Immediate-early protein IE180| Length = 1446 Score = 33.5 bits (75), Expect = 0.56 Identities = 19/38 (50%), Positives = 22/38 (57%) Frame = +2 Query: 155 RPQFSLGSGPLPGPADMLLSHCRSREDEDHRRQARPLG 268 R + SLG GP P PA LLS S ++D R RPLG Sbjct: 928 RKRRSLGLGPAPDPAPALLSSSSSSSEDDRLR--RPLG 963
>Y404_RICPR (Q9ZDC7) Hypothetical protein RP404| Length = 281 Score = 33.1 bits (74), Expect = 0.73 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -1 Query: 586 MEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAA 470 +E IE H F IGVQ+HPE+ + LF L+ A+ Sbjct: 240 VEAIEATKHKFVIGVQWHPEYLNDNGIDLQLFKALVKAS 278
>IE18_PRVIF (P11675) Immediate-early protein IE180| Length = 1461 Score = 32.7 bits (73), Expect = 0.96 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 Query: 155 RPQFSLGSGPLPGPADMLLSHCRSREDEDHRRQARPLG 268 R + SLG GP P PA L+S S + R RPLG Sbjct: 939 RKRRSLGLGPAPDPAPALVSSSSSSSSSEDDRLRRPLG 976
>EFGL_MYCTU (O07170) Elongation factor G-like protein| Length = 714 Score = 31.6 bits (70), Expect = 2.1 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 156 VLNFPWALGRCPALLICCSAIVAVGKMRTTE--DRQDPLAKLTVR*PWVLPLPL 311 VL+FP + PA + I A+GK+ E D A+ V PW +P PL Sbjct: 376 VLSFPLGKQQRPAAAVVAGDICAIGKLSRAETGDTLSDKAEPLVLKPWTMPEPL 429
>HPPA_STRCO (Q9X913) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 794 Score = 31.2 bits (69), Expect = 2.8 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 6/80 (7%) Frame = +2 Query: 134 YYTSCSCRPQFSLGSGPLPGPADMLLSHCR-SREDEDHRRQARPLGEIDGALTMGTAI-- 304 Y+T + RP +G L GPA ++L+ E + LG L GT+I Sbjct: 387 YFTETTRRPVKDIGKSSLTGPATVVLAGISLGLESAVYTALLIGLGVYGAFLLGGTSIML 446 Query: 305 ---AVGMAGSICYTTIGLLL 355 AV +AG+ TT+G+++ Sbjct: 447 ALFAVALAGTGLLTTVGVIV 466
>VIRD4_AGRRH (P13464) Protein virD4| Length = 671 Score = 30.8 bits (68), Expect = 3.6 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = +2 Query: 134 YYTSCSCRPQFSLGSGPLPGPADMLLSHCRSREDEDHRRQ------ARPLGEIDGALTMG 295 YY+ R F G LP PA ++L+ ++ +DH Q A LG+ID + G Sbjct: 530 YYSDRMLRRLFECQIGALPEPASLMLAQDVHQDGQDHLSQQAAVTAALGLGDIDSLVNNG 589
>VIRD4_AGRT5 (P18594) Protein virD4| Length = 668 Score = 30.4 bits (67), Expect = 4.8 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = +2 Query: 134 YYTSCSCRPQFSLGSGPLPGPADMLLSHCRSREDEDHRRQ-----ARPLGEID 277 YY+ R F G LP PA ++LS R+ +D +Q A+ LG+ID Sbjct: 530 YYSDRMLRRLFECQIGALPEPASLMLSEGVHRDGQDLSQQAAVTEAQGLGDID 582
>YLPA_YEREN (P27461) Lipoprotein ylpA precursor| Length = 245 Score = 30.0 bits (66), Expect = 6.2 Identities = 23/82 (28%), Positives = 35/82 (42%) Frame = -1 Query: 511 SKPSPLFVGLIAAACGQLDQVLQDSCNGHVVVAKHKLGDSSSTPLIHQNGHAQKQANGGV 332 S + L VGL A G + + + N + +V ++ + + TPL N A KQ G Sbjct: 139 SAGASLGVGLAAGLVGMVADAMVEDIN-YTMVTDVQISEKTDTPLQTDNVAALKQGTSGY 197 Query: 331 ANGTCHANGNGSTHG*RTVNFA 266 T GN + R V+ A Sbjct: 198 KVQTSTQTGNKHQYQTRVVSSA 219
>YL82_CAEEL (P34440) Hypothetical histone H3-like protein F54C8.2 in chromosome| III Length = 261 Score = 30.0 bits (66), Expect = 6.2 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -1 Query: 448 LQDSCNGHVVVAKHKLGDSSSTPLIHQNGHAQKQANGGVANGTCHANG-NGSTHG 287 L D +G + H+ DSS + N H Q N G N T NG NGS G Sbjct: 88 LVDYSHGRHDMPSHRRHDSSDEEITAANSHHQSPINVGNRNDTDGTNGRNGSRAG 142
>GSCL_MOUSE (P56916) Homeobox protein goosecoid-like (GSC-2)| Length = 198 Score = 29.6 bits (65), Expect = 8.1 Identities = 24/67 (35%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +3 Query: 318 QVPFATPPLACFCAC-PFWCIRGVEELSPSLCLATTTWPLQLSCSTWSSCPHAAAISPTN 494 + P P AC C C P RG E + L LA WPL+L+ +T S A SP Sbjct: 53 EAPVPAAPCACCCCCNPRAATRGTPE-TAGLRLA---WPLRLAPATPSPLTAPRAGSPAL 108 Query: 495 RGEGFEG 515 G G Sbjct: 109 TGTSGPG 115
>ETR2_PELHO (Q9XH57) Ethylene receptor 2 (EC 2.7.13.3) (PhETR2)| Length = 741 Score = 29.6 bits (65), Expect = 8.1 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = -1 Query: 622 LQFVGKDETGQRMEIIEIPDHPFFIGVQFHPEFKSTPSKPSPLFVGLIAAACGQLDQVLQ 443 L+ V +D M++ F I V+ H +F + +P LI A G +DQV + Sbjct: 650 LRVVSQDYKVVFMDVCMPEVDGFEIAVRIHEKFMTRHERP------LIVALTGNIDQVTK 703 Query: 442 DSC 434 D+C Sbjct: 704 DNC 706 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,396,583 Number of Sequences: 219361 Number of extensions: 2468933 Number of successful extensions: 7611 Number of sequences better than 10.0: 139 Number of HSP's better than 10.0 without gapping: 7154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7587 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
