| Clone Name | rbasd1e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_BCMVN (Q65399) Genome polyprotein [Contains: P1 proteinase ... | 30 | 4.6 |
|---|
>POLG_BCMVN (Q65399) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3066 Score = 30.4 bits (67), Expect = 4.6 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = -1 Query: 474 AWLSK*MPLWRLVSLRRVTSEFCRRRVCSGRALTGRQ-VSG*TDSLYNKMQNA-LVIAIF 301 +WL K W+L +VT E ++ GR + R+ VS + + NA + I+ Sbjct: 941 SWLEKSSVTWQLKKFSKVTEEHLTKKAAEGRKESSRKFVSACFMNAQTHLGNARITISNK 1000 Query: 300 GCEITTLYLERIIE 259 E+T L + RI+E Sbjct: 1001 VNEVTNLGVRRIVE 1014 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,751,177 Number of Sequences: 219361 Number of extensions: 1389679 Number of successful extensions: 2448 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2448 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)