Clone Name | rbasd1d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COBQ_VIBCH (Q9KLL6) Cobyric acid synthase | 29 | 6.0 |
---|
>COBQ_VIBCH (Q9KLL6) Cobyric acid synthase| Length = 484 Score = 29.3 bits (64), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 38 AGRSIIILGTNRVLARTCLQYTPSLYKPKN 127 AG+S+++ G RVLAR +Q P +KP+N Sbjct: 14 AGKSVLVAGLCRVLARRGIQVCP--FKPQN 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,422,222 Number of Sequences: 219361 Number of extensions: 981414 Number of successful extensions: 2293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2293 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)