| Clone Name | rbasd1d01 |
|---|---|
| Clone Library Name | barley_pub |
>WEB1_YEAST (P38968) Protein WEB1 (Protein transport protein SEC31)| Length = 1273 Score = 37.4 bits (85), Expect = 0.029 Identities = 29/88 (32%), Positives = 36/88 (40%), Gaps = 3/88 (3%) Frame = -1 Query: 542 NDDPPECRSEPQVSMHPPTGTY---QASISAPSNFGLRPFYCHPPPMQILPRENFAGSMP 372 N P ++P S +PPTG Y S P F P PPP+ + R N S+ Sbjct: 1066 NPYAPTATTQPNGSSYPPTGPYTNNHTMTSPPPVFNKPP--TGPPPISMKKRSNKLASIE 1123 Query: 371 AFPMVGAQRQQVRYSQSLHLTPSRVQPP 288 P GA S + L PS QPP Sbjct: 1124 QNPSQGATYPPTLSSSASPLQPS--QPP 1149
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 34.3 bits (77), Expect = 0.25 Identities = 29/101 (28%), Positives = 37/101 (36%), Gaps = 25/101 (24%) Frame = -1 Query: 512 PQVSMHPPTGTYQASISAPSNFGLR-------------------PFYCHPPPMQILPREN 390 PQ HPP +S PS F L P HPPP+Q++P+ Sbjct: 934 PQAHKHPP------HLSGPSPFSLNANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQSQ 987 Query: 389 FAGSMPAFPMVGAQRQQV------RYSQSLHLTPSRVQPPQ 285 S PA P Q Q + + LH PS+ PQ Sbjct: 988 PLPSSPAQPPGLTQSQSLPPPAASHPTTGLHQVPSQSPFPQ 1028
>NAB3_YEAST (P38996) Nuclear polyadenylated RNA-binding protein 3| Length = 802 Score = 33.1 bits (74), Expect = 0.56 Identities = 27/81 (33%), Positives = 34/81 (41%), Gaps = 3/81 (3%) Frame = -1 Query: 512 PQVSMHPPTGTYQA-SISAPSNFGLRPF--YCHPPPMQILPRENFAGSMPAFPMVGAQRQ 342 P V P T YQ S+ P +P+ Y PPP + GS P PM + Sbjct: 583 PAVGPPPQTNYYQGYSMPPPQQQQQQPYGNYGMPPPSH----DQGYGSQPPIPM---NQS 635 Query: 341 QVRYSQSLHLTPSRVQPPQGY 279 RY S+ P + Q PQGY Sbjct: 636 YGRYQTSIPPPPPQQQIPQGY 656
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 32.3 bits (72), Expect = 0.95 Identities = 28/102 (27%), Positives = 37/102 (36%), Gaps = 26/102 (25%) Frame = -1 Query: 512 PQVSMHPPTGTYQASISAPSNFGLR-------------------PFYCHPPPMQILPREN 390 PQ HPP +S PS F + P HPPP+Q++P+ Sbjct: 933 PQAHKHPP------HLSGPSPFSMNANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQSQ 986 Query: 389 FAGSMPAFPMVGAQRQQV-------RYSQSLHLTPSRVQPPQ 285 S PA P Q Q + + LH PS+ PQ Sbjct: 987 PLPSSPAQPPGLTQSQSLPPPAASHPTTGGLHQVPSQSPFPQ 1028
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 31.2 bits (69), Expect = 2.1 Identities = 26/96 (27%), Positives = 33/96 (34%), Gaps = 19/96 (19%) Frame = -1 Query: 512 PQVSMHPPTGTYQASISAPSNFGLR-------------------PFYCHPPPMQILPREN 390 PQ HPP +S PS F + P HPPP+Q++P+ Sbjct: 942 PQAHKHPP------HLSGPSPFSMNANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQSQ 995 Query: 389 FAGSMPAFPMVGAQRQQVRYSQSLHLTPSRVQPPQG 282 S PA P Q Q + P PP G Sbjct: 996 PLPSSPAQPPGLTQSQNLP-------PPPASHPPTG 1024 Score = 30.0 bits (66), Expect = 4.7 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = -1 Query: 512 PQVSMHPPTGTYQASISAPSNFGLRPFYCHPPPMQILPRENFAGSMPAFPMVGAQ 348 P + HPPTG +Q + P F PF PP P + PA P AQ Sbjct: 1015 PPPASHPPTGLHQVAPQPP--FAQHPFVPGGPPPITPPTCPSTSTPPAGPGTSAQ 1067
>YLPM1_HUMAN (P49750) YLP motif-containing protein 1 (Nuclear protein ZAP3)| (ZAP113) Length = 1951 Score = 30.4 bits (67), Expect = 3.6 Identities = 24/98 (24%), Positives = 39/98 (39%), Gaps = 11/98 (11%) Frame = -1 Query: 539 DDPPECRSEPQVSMHPPTGTYQASISAPSNF----GLRPFY--CHPPPMQILPRENFAGS 378 + PPE P S PP+ +Y P ++ +P+ P P Q P +++ Sbjct: 144 ESPPESPPVPPGSYMPPSQSYMPPPQPPPSYYPPTSSQPYLPPAQPSPSQSPPSQSYLAP 203 Query: 377 MPAFPMVGAQRQQV-----RYSQSLHLTPSRVQPPQGY 279 P++ + Q Y S +PSR P QG+ Sbjct: 204 TPSYSSSSSSSQSYLSHSQSYLPSSQASPSR--PSQGH 239
>ANXA7_DICDI (P24639) Annexin A7 (Annexin VII) (Synexin)| Length = 462 Score = 29.6 bits (65), Expect = 6.1 Identities = 24/90 (26%), Positives = 31/90 (34%), Gaps = 5/90 (5%) Frame = -1 Query: 533 PPECRSEPQVSMHPPTGTYQASISAPSNFGLRPFYCHPPPMQILPRENFAGSMPAFPMVG 354 PP+ PQ +PP Y P G P +PP P++ + P G Sbjct: 35 PPQQGYPPQQG-YPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQG 93 Query: 353 AQRQ-----QVRYSQSLHLTPSRVQPPQGY 279 Q Q Y P + PPQGY Sbjct: 94 YPPQQGYPPQQGYPPQQGYPPQQGYPPQGY 123
>DCP1_ARATH (Q9SJF3) mRNA decapping enzyme-like protein (EC 3.-.-.-) (DCP1| homolog) Length = 367 Score = 29.6 bits (65), Expect = 6.1 Identities = 20/81 (24%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = -1 Query: 497 HPPTGTYQASISAPSNFGLRPFYCHPPPMQILPRENFAGSMPAFPMVGAQRQQVRYSQSL 318 H P +Q +I+ P P PPP+Q S P + + + + ++ Sbjct: 213 HQPHQPHQPTIAPPVAAAAPPQIQSPPPLQ--------SSSPLMTLFDNNPEVISSNSNI 264 Query: 317 H---LTPSRVQPPQGYINPHV 264 H +TPS PP+ PH+ Sbjct: 265 HTDLVTPSFFGPPRMMAQPHL 285
>BRO1_GIBZE (Q4IBS9) Vacuolar protein-sorting protein BRO1 (BRO domain-containing| protein 1) Length = 995 Score = 29.3 bits (64), Expect = 8.0 Identities = 25/98 (25%), Positives = 34/98 (34%), Gaps = 13/98 (13%) Frame = -1 Query: 542 NDDPPECRSEPQVSMHPPTGTYQASISAPSNFGLRPFYCHPPPMQIL------------- 402 N PP + Q PP T+ PS +G P PPP Q Sbjct: 842 NFSPPPTTTTTQSFGPPPINTFVQPTYNPSQYGRTPGPTSPPPNQTSFNIGGYRGPASPP 901 Query: 401 PRENFAGSMPAFPMVGAQRQQVRYSQSLHLTPSRVQPP 288 P ++ G +F GA +Q ++ P V PP Sbjct: 902 PNQSTFGQSQSFGGYGA--SSTPQTQGGYVPPGFVPPP 937
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 29.3 bits (64), Expect = 8.0 Identities = 26/95 (27%), Positives = 34/95 (35%), Gaps = 4/95 (4%) Frame = -1 Query: 533 PPECRSEPQVSMH--PPTGTYQASISAPSNFGLRPFYCHPPPMQIL--PRENFAGSMPAF 366 PP R +PQ + PP Q+ +P+ P Y PPP I P ++ S P Sbjct: 253 PPSPRRQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPPPPAYSPSPPPT 312 Query: 365 PMVGAQRQQVRYSQSLHLTPSRVQPPQGYINPHVY 261 P TP+ PP Y P Y Sbjct: 313 P-----------------TPTFSPPPPAYSPPPTY 330
>PTSP_BOMMO (P82003) Prothoracicostatic peptide precursor (Bom-PTSP)| Length = 274 Score = 25.4 bits (54), Expect(2) = 8.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 399 WQNLHRRWMAVKWPEPKIAWGR 464 WQ+L+ W W + AWG+ Sbjct: 174 WQDLNSAWGKRAWQDMSSAWGK 195 Score = 22.3 bits (46), Expect(2) = 8.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 362 WGKQAWIQQNSPLAKFA 412 WGK+AW NS K A Sbjct: 133 WGKRAWQDLNSAWGKRA 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,130,172 Number of Sequences: 219361 Number of extensions: 2013101 Number of successful extensions: 4576 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4559 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)