Clone Name | rbasd1c23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GPR75_HUMAN (O95800) Probable G-protein coupled receptor 75 | 31 | 3.3 | 2 | AA2AR_HORSE (Q6TLI7) Adenosine A2a receptor | 29 | 9.6 |
---|
>GPR75_HUMAN (O95800) Probable G-protein coupled receptor 75| Length = 540 Score = 30.8 bits (68), Expect = 3.3 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 10/79 (12%) Frame = -1 Query: 243 FFIFFTASTKSVDILCFSCHASPPYHCLLAFXPVLILSIQLLWLI----------FPCCF 94 F +FF++++ D CF+ H + +++ V ++++ L ++ FPC Sbjct: 103 FVLFFSSASSIPDAFCFTFHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTV 162 Query: 93 L*DFLEXWTXFCIVXLRXI 37 L L T F + L + Sbjct: 163 LLTLLLWATSFTLATLATL 181
>AA2AR_HORSE (Q6TLI7) Adenosine A2a receptor| Length = 412 Score = 29.3 bits (64), Expect = 9.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 298 YHGGEGQNQAPGCEEGGLSELDE 366 +H GEG+NQ+ GC EG ++ L E Sbjct: 147 HHWGEGENQSQGCGEGQVACLFE 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,336,973 Number of Sequences: 219361 Number of extensions: 1203981 Number of successful extensions: 2710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2710 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)