Clone Name | rbasd1b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ROAA_EUGGR (P30397) Ribosomal operon-associated A protein (RoaA) | 28 | 8.4 |
---|
>ROAA_EUGGR (P30397) Ribosomal operon-associated A protein (RoaA)| Length = 516 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 94 KNYKVVYSLFYLNHLGSFRLFFLIMF-LHIIKKFIIYFLNI 213 +N+ + Y ++YL ++ F FF + I KK II F ++ Sbjct: 228 ENFFISYKVYYLFYIDKFYFFFKFPYDFFICKKIIISFFSL 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,876,099 Number of Sequences: 219361 Number of extensions: 162923 Number of successful extensions: 871 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)