Clone Name | rbasd0g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BCHG_CHLAU (P33326) Bacteriochlorophyll synthase 34 kDa chain | 30 | 6.0 |
---|
>BCHG_CHLAU (P33326) Bacteriochlorophyll synthase 34 kDa chain| Length = 310 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 464 SWFHPGQEFRCWHISSVAPGWTQEIGIMHQSLALGM 571 +WF P F C I+S A GW + IG L LGM Sbjct: 40 TWFAPTWAFMCGAIASGALGWNESIG----RLLLGM 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,639,241 Number of Sequences: 219361 Number of extensions: 2577643 Number of successful extensions: 5424 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5421 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)