| Clone Name | rbasd0e10 |
|---|---|
| Clone Library Name | barley_pub |
>ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin receptor alpha| subunit) (Integrin alpha-F) (VLA-5) (CD49e antigen) [Contains: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] Length = 1049 Score = 32.7 bits (73), Expect = 0.25 Identities = 21/58 (36%), Positives = 25/58 (43%) Frame = +1 Query: 52 PLGILYLPTCVGFGYRYPFVEGRSSFSWEYGIGYILQRRSAWYEPRGEAIASPRGSYF 225 P+G YL T F + RS FSW G GY SA + G + GSYF Sbjct: 172 PVGTCYLSTD-NFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYF 228
>DOK1_MOUSE (P97465) Docking protein 1 (Downstream of tyrosine kinase 1)| (p62(dok)) Length = 482 Score = 29.3 bits (64), Expect = 2.8 Identities = 27/81 (33%), Positives = 34/81 (41%), Gaps = 12/81 (14%) Frame = -3 Query: 218 EPRGLAIASPRGSY------------QALRR*SM*PMPYSQEKLERPSTKGYLYPKPTQV 75 EP GLA A PRG Y QA + +PY+ P+T Y P P Sbjct: 363 EPEGLAPAPPRGLYDLPQEPRDAWWCQARLKEEGYELPYN------PATDDYAVPPP--- 413 Query: 74 GR*RIPRGHPXLPEVTGLLLP 12 R P+ P P+ GL+LP Sbjct: 414 ---RSPKPAPA-PKPQGLILP 430
>YBIC_ECOLI (P30178) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 162 LKYVTDAILPGKARTTFNKRVPVP 91 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202
>YBIC_ECO57 (P58409) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 162 LKYVTDAILPGKARTTFNKRVPVP 91 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202
>PYGO_DROME (Q9V9W8) Protein pygopus (Protein gammy legs)| Length = 815 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 4 GTRGNNSPVTSGXKGCPLGILYLPTCVGFGYRYP 105 G GN P+ G G P+G+ P +G G YP Sbjct: 697 GPMGNMGPMGGGPMGGPMGVGPKPMTMGGGKMYP 730
>ATRX_DROME (Q9GQN5) Transcriptional regulator ATRX homolog (EC 3.6.1.-)| (ATP-dependent helicase XNP) (X-linked nuclear protein) (dXNP) (d-xnp) Length = 1311 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -1 Query: 157 VCNRCHTPRKSSNDLQQKGTCTRNRHRWVGREYLGGTPXXPKLRGYYC 14 VC+ H + + + T R + R V L GTP LR YYC Sbjct: 613 VCDEGHLLKNEKTSISKAVTRMRTKRRIV----LTGTPLQNNLREYYC 656 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,323,757 Number of Sequences: 219361 Number of extensions: 872927 Number of successful extensions: 2271 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2270 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)