| Clone Name | rbasd0d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCAM_HORCH (Q42829) S-adenosylmethionine decarboxylase proenzyme... | 90 | 1e-18 | 2 | DCAM_ORYSA (O24215) S-adenosylmethionine decarboxylase proenzyme... | 55 | 4e-08 | 3 | DCAM_MAIZE (O24575) S-adenosylmethionine decarboxylase proenzyme... | 47 | 9e-06 | 4 | SMI1_YARLI (Q6CDX0) KNR4/SMI1 homolog | 31 | 0.88 | 5 | YHGE_BACSU (P32399) Hypothetical protein yhgE (ORFB) | 29 | 2.5 | 6 | TRX_DROME (P20659) Protein trithorax | 27 | 9.7 | 7 | MURI2_THETN (Q8RC52) Glutamate racemase 2 (EC 5.1.1.3) | 27 | 9.7 |
|---|
>DCAM_HORCH (Q42829) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 393 Score = 90.1 bits (222), Expect = 1e-18 Identities = 48/61 (78%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = -1 Query: 337 FTANEEVAVSAGSPRSVXXCFEGENVESGHPLVKEGKXNNLLAWRAXEDSLEE--GAVLC 164 F ANEE+AVSAGSPRSV CFE NVESGHPLVKEGK NLLAWRA E+SLEE GA+LC Sbjct: 335 FAANEELAVSAGSPRSVFHCFE--NVESGHPLVKEGKLANLLAWRAEEESLEEGTGALLC 392 Query: 163 E 161 E Sbjct: 393 E 393
>DCAM_ORYSA (O24215) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 398 Score = 55.1 bits (131), Expect = 4e-08 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -1 Query: 337 FTANEEVAVSAGSPRSVXXCFEGENVESGHPLVKEGKXNNLLAWRAXEDSLEE 179 F A E+V V+ GSP+SV CFE EN+ + P VKEGK NLL W ED+LEE Sbjct: 342 FDATEDVPVAVGSPKSVLHCFEAENMVNPAP-VKEGKLGNLLPW--GEDALEE 391
>DCAM_MAIZE (O24575) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 400 Score = 47.4 bits (111), Expect = 9e-06 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -1 Query: 337 FTANEEVAVSAGSPRSVXXCFEGENVESG-HPLVKEGKXNNLLAWRAXEDSLEEGA 173 F A E+ A SP+SV CF+GENVES P+ K+ K NLL W D++EE A Sbjct: 342 FCAAEDAV--ATSPKSVFHCFDGENVESAPPPMKKDYKLANLLCWEEEADAMEEKA 395
>SMI1_YARLI (Q6CDX0) KNR4/SMI1 homolog| Length = 713 Score = 30.8 bits (68), Expect = 0.88 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 7/60 (11%) Frame = -1 Query: 328 NEEVAVSAG-SPRSVXXCFEGENVES------GHPLVKEGKXNNLLAWRAXEDSLEEGAV 170 N E+A + G +P F N S G P+ + N+ +W A +DS+ EGAV Sbjct: 238 NREIARATGQTPTKQGGIFINPNAGSPNSSTPGSPVASVARQKNISSWLASQDSVPEGAV 297
>YHGE_BACSU (P32399) Hypothetical protein yhgE (ORFB)| Length = 775 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 277 FEGENVESGHPLVKEGKXNNLLAWRAXED 191 +EGE ++ G LVKE K NN W D Sbjct: 62 YEGEKLQIGDDLVKELKDNNNFDWHFSND 90
>TRX_DROME (P20659) Protein trithorax| Length = 3726 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 Query: 241 VKEGKXNNLLAWRAXEDSLEEGAVLCE**DDFCCRCSVCGIRSDFRLSFWL 89 V G + LL + + +D LEE A C RC RS++ + WL Sbjct: 3500 VSGGDSHGLLDYGSDQDELEENAY-------DCARCEPYSNRSEYDMFSWL 3543
>MURI2_THETN (Q8RC52) Glutamate racemase 2 (EC 5.1.1.3)| Length = 264 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 247 PLVKEGKXNNLLAWRAXEDSLEE 179 PL+++G N+ LA++A +D LEE Sbjct: 146 PLIEKGLYNSHLAYKAAKDCLEE 168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,899,685 Number of Sequences: 219361 Number of extensions: 474251 Number of successful extensions: 1141 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)