Clone Name | rbasd0d10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PERN_IPOBA (O04796) Neutral peroxidase precursor (EC 1.11.1.7) (... | 30 | 3.7 | 2 | NODU_AZOCA (Q07759) Nodulation protein U (EC 2.1.3.-) | 30 | 4.8 | 3 | RPOC1_ODOSI (P49467) DNA-directed RNA polymerase beta' chain (EC... | 29 | 6.3 |
---|
>PERN_IPOBA (O04796) Neutral peroxidase precursor (EC 1.11.1.7) (SwPN1)| Length = 348 Score = 30.0 bits (66), Expect = 3.7 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 357 PCLCSSARGVAIVQLSKKNAQSPCRCSPIS 446 P +S RG +++ +K+NAQ+ C +P+S Sbjct: 126 PANSNSVRGFSVIDQAKRNAQTKCADTPVS 155
>NODU_AZOCA (Q07759) Nodulation protein U (EC 2.1.3.-)| Length = 560 Score = 29.6 bits (65), Expect = 4.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 34 EHLDKIGLVPHKKNLQMSNAEPYLESGW 117 EH D+I L H+ Q S+ + Y+ GW Sbjct: 41 EHTDEIALALHRSGFQPSDIDEYIIDGW 68
>RPOC1_ODOSI (P49467) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta' subunit) (RNA polymerase beta' subunit) Length = 843 Score = 29.3 bits (64), Expect = 6.3 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = -3 Query: 455 NEVRYGATPAWGLCVFLGKLHNSHSPCRTAETRSHA*FAVNELWRRMVKG*N----LLRI 288 N + G+ PAW + L + + P E A +NEL+RR++ N LL I Sbjct: 452 NLLATGSNPAWMILTILPVIPPALRPMIQLEGGRFATSDLNELYRRIITRNNRLLRLLEI 511 Query: 287 DAAVCCVRIQK 255 DA +R +K Sbjct: 512 DAPQLIIRNEK 522 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,287,135 Number of Sequences: 219361 Number of extensions: 1578998 Number of successful extensions: 3024 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3024 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)