Clone Name | rbasd0a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DPO3E_TREPA (O83649) DNA polymerase III epsilon subunit (EC 2.7.... | 32 | 1.7 | 2 | SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precurs... | 30 | 6.5 | 3 | PME1_FICAW (P83947) Pectinesterase precursor (EC 3.1.1.11) (Pect... | 29 | 8.5 |
---|
>DPO3E_TREPA (O83649) DNA polymerase III epsilon subunit (EC 2.7.7.7)| Length = 215 Score = 31.6 bits (70), Expect = 1.7 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -1 Query: 435 ALHRARDDGRVDL-----LLHDPCGQQGHDLRHAGSGTTKKQVME 316 A HRA DD RV + ++ Q GH + HA S T KK + E Sbjct: 158 AAHRAEDDARVCMELFTTMIAHHAKQNGHCVNHAQSPTIKKLIQE 202
>SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precursor (Acetyl LDL| receptor) (Scavenger receptor class F member 1) Length = 830 Score = 29.6 bits (65), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 347 PAWRRSCPCWPHGSC 391 P R SCPC PHG C Sbjct: 97 PDCRESCPCHPHGQC 111
>PME1_FICAW (P83947) Pectinesterase precursor (EC 3.1.1.11) (Pectin| methylesterase) (PE) Length = 545 Score = 29.3 bits (64), Expect = 8.5 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = -1 Query: 573 DDKVEFGYSKKDVLLIGVGV 514 ++ V+FGY KK+V+L+G G+ Sbjct: 271 EENVDFGYQKKNVMLVGEGM 290 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,446,237 Number of Sequences: 219361 Number of extensions: 1008658 Number of successful extensions: 2419 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2418 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)