| Clone Name | rbaak19c21 |
|---|---|
| Clone Library Name | barley_pub |
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 84.0 bits (206), Expect = 1e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 177 KGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 67 KGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF Sbjct: 428 KGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 464
>RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 474 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 177 KGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 67 KGAQQ LPVPEGCTD A+N+DPTARSDDG+C+Y F Sbjct: 438 KGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
>RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase activase 1,| chloroplast precursor (RuBisCO activase 1) (RA 1) (RubisCO activase alpha form) Length = 476 Score = 62.0 bits (149), Expect = 4e-10 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 168 QQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 67 Q G +PVPEGCTD A NYDPTARSDDGSC+Y F Sbjct: 443 QVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
>RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 472 Score = 61.6 bits (148), Expect = 5e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 177 KGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLY 73 K AQQ +LPV +GCTD AKNYDPTARSDDGSC Y Sbjct: 436 KAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 84 CRRRSLPLGRSSWHFGRCNLP 146 CRR P GR H GRCN P Sbjct: 2114 CRRCQCPGGRCDPHTGRCNCP 2134
>YKB4_YEAST (P34241) Hypothetical 203.3 kDa protein in PUT3-ARC19 intergenic| region Length = 1764 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 150 VPEGCTDQNAKNYDPTARSD 91 VPE TD N NYD T R D Sbjct: 1383 VPELYTDSNTNNYDATTRCD 1402
>CCMF_ARATH (P93286) Putative cytochrome c biogenesis ccmF-like mitochondrial| protein Length = 442 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 154 ARAGRLHRPKCQELRPNGKERRR 86 A+ R R K Q LRPNG E+RR Sbjct: 147 AKRERARRRKGQTLRPNGNEQRR 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,872,740 Number of Sequences: 219361 Number of extensions: 381386 Number of successful extensions: 954 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)