Clone Name | rbaak4p20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CRTC3_ARATH (O04153) Calreticulin-3 precursor | 31 | 1.3 | 2 | MS84D_DROME (Q01645) Male-specific sperm protein Mst84Dd | 31 | 1.3 | 3 | MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich p... | 30 | 2.2 | 4 | MS87F_DROME (P08175) Male-specific sperm protein Mst87F | 30 | 2.9 | 5 | FTR_RHOBA (Q7UKZ8) Formylmethanofuran--tetrahydromethanopterin f... | 29 | 3.7 |
---|
>CRTC3_ARATH (O04153) Calreticulin-3 precursor| Length = 424 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/18 (77%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -3 Query: 253 RYKRRN-RDHWDDYHDEL 203 RYKR N RD+ DDYHDEL Sbjct: 407 RYKRPNPRDYMDDYHDEL 424
>MS84D_DROME (Q01645) Male-specific sperm protein Mst84Dd| Length = 72 Score = 30.8 bits (68), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 223 PSDPCCVFCICPCSGPCHG 279 P PCC C PC GPC G Sbjct: 12 PCGPCCGPCCGPCCGPCCG 30 Score = 28.9 bits (63), Expect = 4.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 232 PCCVFCICPCSGPCHG 279 PCC C PC GPC G Sbjct: 19 PCCGPCCGPCCGPCCG 34
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 30.0 bits (66), Expect = 2.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 223 PSDPCCVFCICPCSGPC 273 P PCC +CPC PC Sbjct: 43 PKSPCCTPKVCPCPTPC 59
>MS87F_DROME (P08175) Male-specific sperm protein Mst87F| Length = 56 Score = 29.6 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 223 PSDPCCVFCICPCSGPC 273 P PCC C PC GPC Sbjct: 5 PCGPCCGPCCGPCCGPC 21
>FTR_RHOBA (Q7UKZ8) Formylmethanofuran--tetrahydromethanopterin| formyltransferase (EC 2.3.1.101) (H4MPT formyltransferase) Length = 334 Score = 29.3 bits (64), Expect = 3.7 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 47 ALLSHXNDLRGQFNQFPSHETRNTSIIGSNYNAMFMS-NPSF 169 A + +L G FP TR+ S +GS Y A+F S N SF Sbjct: 205 AAIDAMRELPGIITPFPGGTTRSGSKVGSKYAALFASTNDSF 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,312,579 Number of Sequences: 219361 Number of extensions: 593584 Number of successful extensions: 1414 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1410 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)