Clone Name | rbaak4p15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-) | 29 | 3.1 |
---|
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 29.3 bits (64), Expect = 3.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 33 TYTYS*EQIXKINGEGKPKAMSELTKLQWHFICGPSSV 146 T+ Y I +NGEG K + L ++ +CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,217,855 Number of Sequences: 219361 Number of extensions: 331746 Number of successful extensions: 720 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)