Clone Name | rbaak4p11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CARA_ZYMMO (O50235) Carbamoyl-phosphate synthase small chain (EC... | 28 | 6.4 | 2 | RRPP_PIRYV (Q01769) Phosphoprotein (P protein) | 28 | 8.4 |
---|
>CARA_ZYMMO (O50235) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 374 Score = 28.1 bits (61), Expect = 6.4 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -2 Query: 214 MAERARSGAVKAGMDVRESLSPKQKGDWQDVALMSLSFAVYVYISQK 74 + E ARS A GMD+ S+S Q +WQ+ + SL V +QK Sbjct: 139 LIETARSWAGLQGMDLARSVSTHQSYNWQE-GIWSLQNGYSVVDNQK 184
>RRPP_PIRYV (Q01769) Phosphoprotein (P protein)| Length = 327 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -2 Query: 214 MAERARSGAVKAGMDVRESLSPKQKGDWQD--VALMSLS 104 M ++ +G + A + + L+PKQ W D +ALM LS Sbjct: 113 MVQKTVNGKLVAELSAPQGLTPKQLSQWTDSVLALMDLS 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,718,813 Number of Sequences: 219361 Number of extensions: 213515 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)