Clone Name | rbaak4p09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BCA3_HUMAN (Q9NQ31) Proline-rich protein BCA3 (Breast cancer-ass... | 30 | 2.3 | 2 | PEPT_LISMF (Q71YN8) Peptidase T (EC 3.4.11.4) (Tripeptide aminop... | 29 | 3.0 | 3 | YOT7_CAEEL (P34653) Hypothetical protein ZK632.7 | 28 | 8.7 |
---|
>BCA3_HUMAN (Q9NQ31) Proline-rich protein BCA3 (Breast cancer-associated gene 3| protein) (PKA-interacting protein) (AKIP1) Length = 210 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 37 MCLLKGVNKQSNTDTKTDTTVSGQVELAQRTYSSLSPMENITEDLFMYMY 186 MCL G N Q KT G ++++ + P ENI++DL++ +Y Sbjct: 128 MCLDIG-NGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVY 176
>PEPT_LISMF (Q71YN8) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 410 Score = 29.3 bits (64), Expect = 3.0 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 55 VNKQSNTDTKTDTTVSGQVELAQRTYSSLSP--MENITEDLFMYM 183 V+ QSN ++K T GQ+ELA + L M+ +T D F Y+ Sbjct: 15 VDTQSNEESKACPTTPGQMELANILVTELKEIGMQEVTVDEFGYV 59
>YOT7_CAEEL (P34653) Hypothetical protein ZK632.7| Length = 632 Score = 27.7 bits (60), Expect = 8.7 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 55 VNKQSNTDTKTDTTVSGQVELAQRTYSSLSPME 153 +N+Q DTK D+ + G + + +S+L P+E Sbjct: 214 INRQLAYDTKADSAIIGDIPHSVEHFSNLVPLE 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,714,029 Number of Sequences: 219361 Number of extensions: 495503 Number of successful extensions: 1242 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)