Clone Name | rbaak4o14 |
---|---|
Clone Library Name | barley_pub |
>GLNA_FREDI (P33035) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) Length = 470 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 9/47 (19%) Frame = +1 Query: 211 NQSWADP----PTLXX-----DPRTQDYYFHCPRGFSLSAGETVTRT 324 N +W DP PTL +PRT ++Y CPR + A + + T Sbjct: 73 NTAWIDPFMKEPTLSIICSIKEPRTGEWYNRCPRVIAQKAIDYLVST 119
>GLNA_ANASP (P00964) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) Length = 473 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 9/47 (19%) Frame = +1 Query: 211 NQSWADP----PTLXX-----DPRTQDYYFHCPRGFSLSAGETVTRT 324 N +W DP PTL +PRT ++Y CPR + A + + T Sbjct: 73 NTAWIDPFMEVPTLSIVCSIKEPRTGEWYNRCPRVIAQKAIDYLVST 119
>NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2498 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +2 Query: 167 NSQLTNKANVLDLTATKAGPTRRPXXXTHGPRTTTSIVPEVSPCPQEKP 313 N+Q K V A++A T P TTTS V+P P P Sbjct: 568 NNQGRRKGRVTRSMASEAAAANAVTTATTAPVTTTSTATTVAPVPVAPP 616
>ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein 38 (Zinc| finger protein expressed in neurons) (Zenon) Length = 1203 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 140 PS*HHITRVNSQLTNKANVLDLTATKAGPTRRPXXXTHGPRTTTSIVP-EVSPCPQ 304 P H + +S T K N LT TKA P R+P T +TT +P + CP+ Sbjct: 236 PLREHDSSSSSGKTGKENGEALT-TKAKPCRKPKTQTQDSDSTTENMPLPLVTCPE 290
>LYAM2_RAT (P98105) E-selectin precursor (Endothelial leukocyte adhesion| molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD62E antigen) Length = 549 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 271 FHCPRGFSLSAGETVTRTDSSSEMQASLPS 360 F C RG+ S+ ET R SS E A P+ Sbjct: 208 FSCERGYVPSSMETTVRCTSSGEWSAPAPA 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,083,030 Number of Sequences: 219361 Number of extensions: 913854 Number of successful extensions: 1837 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1835 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)