Clone Name | rbaak4n17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CAHC_HORVU (P40880) Carbonic anhydrase, chloroplast precursor (E... | 52 | 5e-07 | 2 | CAHC_TOBAC (P27141) Carbonic anhydrase, chloroplast precursor (E... | 29 | 3.2 | 3 | CAH2_FLALI (P46513) Carbonic anhydrase 2 (EC 4.2.1.1) (Carbonate... | 29 | 3.2 |
---|
>CAHC_HORVU (P40880) Carbonic anhydrase, chloroplast precursor (EC 4.2.1.1)| (Carbonate dehydratase) Length = 324 Score = 52.0 bits (123), Expect = 5e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 109 GXXXSFXXVXXWVRXGXPXXXKVQXECASMPFDDQC 2 G SF V WVR G P KVQ ECASMPFDDQC Sbjct: 240 GADDSFHFVEDWVRIGFPAKKKVQTECASMPFDDQC 275
>CAHC_TOBAC (P27141) Carbonic anhydrase, chloroplast precursor (EC 4.2.1.1)| (Carbonate dehydratase) Length = 321 Score = 29.3 bits (64), Expect = 3.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 97 SFXXVXXWVRXGXPXXXKVQXECASMPFDDQC 2 S + WV+ G P KVQ E F DQC Sbjct: 231 STAFIEDWVKIGLPAKAKVQGEHVDKCFADQC 262
>CAH2_FLALI (P46513) Carbonic anhydrase 2 (EC 4.2.1.1) (Carbonate dehydratase| 2) (Fragment) Length = 190 Score = 29.3 bits (64), Expect = 3.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 85 VXXWVRXGXPXXXKVQXECASMPFDDQC 2 + WV+ G P KV+ C ++ F D C Sbjct: 104 IEQWVKLGLPAKSKVKANCNNLEFADLC 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,183,037 Number of Sequences: 219361 Number of extensions: 47319 Number of successful extensions: 56 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 80,573,946 effective HSP length: 12 effective length of database: 77,941,614 effective search space used: 1870598736 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)