Clone Name | rbaak4n03 |
---|---|
Clone Library Name | barley_pub |
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 54.7 bits (130), Expect = 6e-08 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -3 Query: 266 VXKXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESGKA 147 V K A V + G DNL QVQCVSFIAFRP CEESGKA Sbjct: 135 VKKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 53.9 bits (128), Expect = 1e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -3 Query: 266 VXKXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESGKA 147 V K A V + G DN+ QVQCVSFIAFRP CEESGKA Sbjct: 136 VKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 53.1 bits (126), Expect = 2e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -3 Query: 266 VXKXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESGKA 147 V K A V I G DN+ QVQCVSFIAF+P CEESGKA Sbjct: 74 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 52.0 bits (123), Expect = 4e-07 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -3 Query: 266 VXKXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESGKA 147 V K A V I G DN+ QVQCVSFIAF+P C+ESGKA Sbjct: 135 VKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESG 153 K A V I G DN+ QVQ +SFIA++P CEESG Sbjct: 138 KAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 42.7 bits (99), Expect = 2e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -3 Query: 233 IXGXDNLXQVQCVSFIAFRPTXCEESGKA 147 I G DN+ QVQ VSFIA +P CEESGKA Sbjct: 147 IIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESG 153 K A + I G DN+ QVQ +SFIA++P CEESG Sbjct: 138 KAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 38.1 bits (87), Expect = 0.006 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRPTXCEESG 153 K A V I G DN+ QVQ +SFIA+ P CEESG Sbjct: 136 KAYPDAFVRIIGFDNVRQVQLISFIAYNP-GCEESG 170
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 37.0 bits (84), Expect = 0.013 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN QVQCVSFIAF+P Sbjct: 149 KAYPSAFIRIIGFDNKRQVQCVSFIAFKP 177
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 36.6 bits (83), Expect = 0.017 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQCVSFIA++P Sbjct: 149 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 36.6 bits (83), Expect = 0.017 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQCVSFIA++P Sbjct: 150 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 36.6 bits (83), Expect = 0.017 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQCVSFIA++P Sbjct: 153 KAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRPT 171 A + I G DN QVQC+SFIA++PT Sbjct: 154 AFIRIIGFDNNRQVQCISFIAYKPT 178
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A V I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A V I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A V I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A V I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWVRIIGFDNVRQVQCISFIAYKP 177
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 150 KAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 36.2 bits (82), Expect = 0.022 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A V I G DN+ QVQC+SFIA++P Sbjct: 150 KAYPQAWVRIIGFDNVRQVQCISFIAYKP 178
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 35.8 bits (81), Expect = 0.029 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA++P Sbjct: 152 AFIRIIGFDNVRQVQCISFIAYKP 175
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 35.8 bits (81), Expect = 0.029 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA++P Sbjct: 156 AFIRIIGFDNVRQVQCISFIAYKP 179
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRPT 171 V I G DN QVQC+SFIA++PT Sbjct: 155 VRIIGFDNKRQVQCISFIAYKPT 177
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRPT 171 V I G DN QVQC+SFIA++PT Sbjct: 155 VRIIGFDNKRQVQCISFIAYKPT 177
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRPT 171 V I G DN QVQC+SFIA++PT Sbjct: 155 VRIIGFDNKRQVQCISFIAYKPT 177
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRPT 171 V I G DN QVQC+SFIA++PT Sbjct: 155 VRIIGFDNKRQVQCISFIAYKPT 177
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRPT 171 V I G DN QVQC+SFIA++PT Sbjct: 155 VRIIGFDNKRQVQCISFIAYKPT 177
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPNAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPNAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 149 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 35.8 bits (81), Expect = 0.029 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRPT 171 A + I G DN+ QVQCVSFIA +PT Sbjct: 147 AWIRIIGFDNVRQVQCVSFIASKPT 171
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRPT 171 V I G DN QVQC+SFIA++PT Sbjct: 151 VRIIGFDNKRQVQCISFIAYKPT 173
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 35.8 bits (81), Expect = 0.029 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN QVQCVSFIA++P Sbjct: 151 KAYPSAFIRIIGFDNKRQVQCVSFIAYKP 179
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 150 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRPTXCEES 156 A + I G DN QVQC+SFIA++P E+ Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 150 KAYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRPTXCEES 156 A + I G DN QVQC+SFIA++P E+ Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 35.8 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN+ QVQC+SFIA++P Sbjct: 150 KSYPQAWIRIIGFDNVRQVQCISFIAYKP 178
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 35.8 bits (81), Expect = 0.029 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN QVQCVSFIA++P Sbjct: 152 KAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 35.4 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + + G DN+ QVQC+SFIA++P Sbjct: 156 AFIRVIGFDNVRQVQCISFIAYKP 179
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA++P Sbjct: 155 AWIRIIGFDNVRQVQCISFIAYKP 178
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 35.0 bits (79), Expect = 0.050 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A V I G DN QVQC+SFIA++P Sbjct: 153 AHVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 35.0 bits (79), Expect = 0.050 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A I G DN+ QVQC+SFIA++P Sbjct: 147 KAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN QVQC+SFIA++P Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKP 175
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K + + I G DN+ QVQC+SFIA++P Sbjct: 152 KAYPQSFIRIIGFDNVRQVQCISFIAYKP 180
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K + + I G DN+ QVQC+SFIA++P Sbjct: 152 KAYPQSFIRIIGFDNVRQVQCISFIAYKP 180
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN QVQC+SFIA++P Sbjct: 152 AFIRIIGFDNTRQVQCISFIAYKP 175
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 34.7 bits (78), Expect = 0.065 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRP 174 + I G DN+ QVQC+SFIA++P Sbjct: 154 IRIIGFDNVRQVQCISFIAYKP 175
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 34.7 bits (78), Expect = 0.065 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRP 174 + I G DN+ QVQC+SFIA++P Sbjct: 154 IRIIGFDNVRQVQCISFIAYKP 175
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 34.7 bits (78), Expect = 0.065 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRP 174 + I G DN+ QVQC+SFIA++P Sbjct: 154 IRIIGFDNVRQVQCISFIAYKP 175
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 34.3 bits (77), Expect = 0.085 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K + + I G DN QVQC+SFIA++P Sbjct: 151 KTYPTSHIRIIGFDNKRQVQCISFIAYKP 179
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 34.3 bits (77), Expect = 0.085 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN QVQC+SFIA++P Sbjct: 53 AFIRIIGFDNNRQVQCISFIAYKP 76
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 34.3 bits (77), Expect = 0.085 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 233 IXGXDNLXQVQCVSFIAFRPTXCE 162 I G DN+ QVQC+SF+A++P E Sbjct: 160 IIGFDNVRQVQCISFLAYKPKGAE 183
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 34.3 bits (77), Expect = 0.085 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN QVQC+SFIA++P Sbjct: 152 ALIRIIGFDNNRQVQCISFIAYKP 175
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 34.3 bits (77), Expect = 0.085 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN QVQC+SFIA++P Sbjct: 152 AFIRIIGFDNNRQVQCISFIAYKP 175
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 34.3 bits (77), Expect = 0.085 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN QVQC+SFIA++P Sbjct: 152 AFIRIIGFDNNRQVQCISFIAYKP 175
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A V I G DN+ QVQC+SFIA P Sbjct: 154 AFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A V I G DN+ QVQC+SFIA P Sbjct: 154 AFVRIIGFDNVRQVQCISFIAHTP 177
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 152 AWIRIIGFDNVRQVQCISFIASKP 175
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 152 AWIRIIGFDNVRQVQCISFIASKP 175
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 33.5 bits (75), Expect = 0.14 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + + G DN+ QVQCVSFI RP Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKP 170
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKP 170
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKP 170
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKP 170
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA +P Sbjct: 147 AWIRIIGFDNVRQVQCISFIASKP 170
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 33.1 bits (74), Expect = 0.19 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -3 Query: 233 IXGXDNLXQVQCVSFIAFRP 174 I G DN+ QVQC+SF+A++P Sbjct: 160 IIGFDNVRQVQCISFLAYKP 179
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -3 Query: 233 IXGXDNLXQVQCVSFIAFRP 174 + G DN+ Q QCVSFIA++P Sbjct: 147 VIGFDNIKQTQCVSFIAYKP 166
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G D+ QVQCVSFIA++P Sbjct: 154 AFIRIIGFDSNRQVQCVSFIAYKP 177
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+SFIA P Sbjct: 152 AFIRIIGFDNVRQVQCISFIASTP 175
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + I G DN+ QVQC+ FIA RP Sbjct: 152 AWIRIIGFDNVRQVQCIMFIASRP 175
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + + G DN+ QVQC+SFI +P Sbjct: 158 KAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 32.7 bits (73), Expect = 0.25 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + + G DN+ QVQC+SFI +P Sbjct: 142 KAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 32.3 bits (72), Expect = 0.32 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + + G DN+ QVQCVSFI +P Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 32.3 bits (72), Expect = 0.32 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + + G DN+ QVQCVSFI +P Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 32.3 bits (72), Expect = 0.32 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + + G DN+ QVQCVSFI +P Sbjct: 150 KEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A + + G DN+ QVQC+SFI +P Sbjct: 154 AFIRVIGFDNIRQVQCISFIVAKP 177
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRP 174 + I G DN+ QVQC+SFIA P Sbjct: 156 IRIIGFDNVRQVQCISFIAHTP 177
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 31.6 bits (70), Expect = 0.55 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 260 KXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 K A + I G DN QVQ +SFIA++P Sbjct: 151 KAYPSAFIRIIGFDNKRQVQIISFIAYKP 179
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 245 AXVXIXGXDNLXQVQCVSFIAFRP 174 A V + G +N+ QVQC+SFIA P Sbjct: 110 AFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 233 IXGXDNLXQVQCVSFIAFRP 174 I G DN QVQC+SF+ ++P Sbjct: 156 IIGFDNTRQVQCISFLTYKP 175
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 266 VXKXXXXAXVXIXGXDNLXQVQCVSFIAFRP 174 V K A V G ++ +VQC+SFIA++P Sbjct: 90 VKKAPPDAFVRFIGFNDKREVQCISFIAYKP 120
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 227 GXDNLXQVQCVSFIAFRPT 171 G DN QVQC SFI +PT Sbjct: 161 GFDNTRQVQCASFIVHQPT 179
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 233 IXGXDNLXQVQCVSFIAFRPTXCE 162 I G DN+ Q Q ++FIA++P E Sbjct: 145 ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRP 174 + + G DN+ Q Q VSFI RP Sbjct: 86 IRVAGFDNIKQCQTVSFIVHRP 107
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 239 VXIXGXDNLXQVQCVSFIAFRP 174 + + G DN+ Q Q VSFI ++P Sbjct: 85 IRVVGFDNIKQCQTVSFIVYKP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,986,287 Number of Sequences: 219361 Number of extensions: 380277 Number of successful extensions: 677 Number of sequences better than 10.0: 92 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)