Clone Name | rbaak4m15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MBHS_RHOGE (P17633) Uptake hydrogenase small subunit precursor (... | 30 | 1.7 | 2 | WDHD1_XENLA (O13046) WD repeat and HMG-box DNA-binding protein 1... | 28 | 6.5 |
---|
>MBHS_RHOGE (P17633) Uptake hydrogenase small subunit precursor (EC 1.12.99.6)| (Hydrogenlyase) (Membrane-bound hydrogenase small subunit) Length = 361 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 4 IFRHNIPRDEDLVAPTCNCLVKWQPCHSW 90 I R +PR+ VA C ++ W C SW Sbjct: 131 IQRQALPREAQAVAADCKAVIAWGSCASW 159
>WDHD1_XENLA (O13046) WD repeat and HMG-box DNA-binding protein 1 (Acidic| nucleoplasmic DNA-binding protein 1) (And-1) Length = 1127 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 117 DDYMXKSCHPAVAWLPFYQ-AVAGGSDEVLVAWNVVSE 7 DD++ + + VAW P Q VAG D +VAWN+ ++ Sbjct: 226 DDFITQPVN-IVAWSPCGQYLVAGSVDGCIVAWNIATK 262 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,416,065 Number of Sequences: 219361 Number of extensions: 397460 Number of successful extensions: 1056 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)