| Clone Name | rbaak4l12 |
|---|---|
| Clone Library Name | barley_pub |
>SNF7_CANGA (Q6FW96) Vacuolar sorting protein SNF7 (Vacuolar protein| sorting-associated protein VPS32) Length = 228 Score = 36.2 bits (82), Expect = 0.075 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPL 518 D VD+TMDEI EQ E ++I DA+S PL Sbjct: 122 DRVDETMDEIREQVELGEEISDAISRPL 149
>SNF7_YEAST (P39929) Vacuolar sorting protein SNF7 (DOA4-independent| degradation protein 1) (Vacuolar protein sorting-associated protein VPS32) Length = 240 Score = 35.8 bits (81), Expect = 0.098 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPL 518 D VD+TMDEI EQ E +I DA+S PL Sbjct: 124 DKVDETMDEIREQVELGDEISDAISRPL 151
>SNF7_CANAL (Q5ABD0) Vacuolar sorting protein SNF7 (Vacuolar protein| sorting-associated protein VPS32) Length = 226 Score = 33.9 bits (76), Expect = 0.37 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPLG 515 D V+ TMDEI EQ E +I +A+S P+G Sbjct: 122 DKVEDTMDEIREQVELADEISEAISRPVG 150
>CHM4A_HUMAN (Q9BY43) Charged multivesicular body protein 4a| (Chromatin-modifying protein 4a) (CHMP4a) (Vacuolar protein sorting 7-1) (SNF7-1) (hSnf-1) (SNF7 homolog associated with Alix-2) Length = 222 Score = 33.5 bits (75), Expect = 0.49 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPLG 515 D VD+ M +I EQ E +QI DA+S P+G Sbjct: 123 DKVDELMTDITEQQEVAQQISDAISRPMG 151
>SNF7_ASHGO (Q753W3) Vacuolar sorting protein SNF7 (Vacuolar protein| sorting-associated protein VPS32) Length = 237 Score = 33.1 bits (74), Expect = 0.64 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 595 VDKTMDEINEQTENMKQIQDALSAPL 518 VD+TMDEI EQ E ++I +A+S PL Sbjct: 125 VDETMDEIREQVELGEEISEAISRPL 150
>SNF7_DEBHA (Q6BSH2) Vacuolar sorting protein SNF7 (Vacuolar protein| sorting-associated protein VPS32) Length = 226 Score = 33.1 bits (74), Expect = 0.64 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPLG 515 D V+ TMD+I EQ E +I +A+S P+G Sbjct: 121 DKVENTMDDIREQVELADEISEAISRPVG 149
>SNF7_CRYNE (Q5KL29) Vacuolar sorting protein SNF7 (Vacuolar protein| sorting-associated protein VPS32) Length = 220 Score = 31.6 bits (70), Expect = 1.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPLG 515 + VD TMD+I EQ + I DA+S P+G Sbjct: 122 EGVDATMDKIREQMDLTNDISDAISNPVG 150
>CHM4C_BRARE (Q6IQ73) Charged multivesicular body protein 4c| (Chromatin-modifying protein 4c) (CHMP4c) Length = 224 Score = 31.6 bits (70), Expect = 1.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPLG 515 D VD M +I EQ E ++I DA+S P+G Sbjct: 124 DKVDDLMQDITEQQELAQEISDAISRPVG 152
>CHM4B_BRARE (Q7ZVC4) Charged multivesicular body protein 4b| (Chromatin-modifying protein 4b) (CHMP4b) Length = 220 Score = 31.2 bits (69), Expect = 2.4 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 601 DDVDKTMDEINEQTENMKQIQDALSAPLG 515 D VD+ M +I EQ E ++I DA+S P+G Sbjct: 124 DKVDELMQDIIEQQELAQEISDAISKPVG 152
>AXN_DROME (Q9V407) Axin (Axis inhibition protein) (dAxin) (d-Axin)| Length = 745 Score = 30.4 bits (67), Expect = 4.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 253 SSQPFVHFTSSFTGGLITMPFQLAVQQAHPPQ 348 S QP F+SS +GG I++P Q A PP+ Sbjct: 634 SQQPLASFSSSSSGGSISLPHQPPPLPAKPPE 665
>AT1A2_HUMAN (P50993) Sodium/potassium-transporting ATPase alpha-2 chain| precursor (EC 3.6.3.9) (Sodium pump 2) (Na+/K+ ATPase 2) Length = 1020 Score = 29.6 bits (65), Expect = 7.0 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 335 LILLSRGFLXSRASWLRLAWDRRRMN 412 +IL GFL SR +RL WD R MN Sbjct: 868 VILAENGFLPSRLLGIRLDWDDRTMN 893 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,241,174 Number of Sequences: 219361 Number of extensions: 1427996 Number of successful extensions: 3977 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3974 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)