| Clone Name | rbaak4l10 |
|---|---|
| Clone Library Name | barley_pub |
>DRTS_CRIFA (Q23695) Bifunctional dihydrofolate reductase-thymidylate synthase| (DHFR-TS) [Includes: Dihydrofolate reductase (EC 1.5.1.3); Thymidylate synthase (EC 2.1.1.45)] Length = 515 Score = 29.3 bits (64), Expect = 4.4 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = -2 Query: 281 MAHQRS*SNGCTISLVDSTEAXXTPKVCQQNGVLPCPFSLVNSTAXPHIYSNHVQ--KMQ 108 M +QR G + ++ A T + + G+ P LV++ H+YSNHV+ K Q Sbjct: 413 MLYQRCCDMGLGVPFNIASYALLTILIAKATGLRPG--ELVHTLGTAHVYSNHVEALKEQ 470 Query: 107 LKXLLILF 84 L+ + + F Sbjct: 471 LQRVPVAF 478
>GCM1_HUMAN (Q9NP62) Chorion-specific transcription factor GCMa (Glial cells| missing homolog 1) (GCM motif protein 1) (hGCMa) Length = 436 Score = 29.3 bits (64), Expect = 4.4 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -2 Query: 248 TISLVDSTEAXXTPKVCQQNGVLPCPFSLVNSTAXPHIYSNHV 120 ++SL STE P Q G LP +S P YS H+ Sbjct: 180 SLSLKGSTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHL 222
>DRTS_TRYCR (Q27793) Bifunctional dihydrofolate reductase-thymidylate synthase| (DHFR-TS) [Includes: Dihydrofolate reductase (EC 1.5.1.3); Thymidylate synthase (EC 2.1.1.45)] Length = 521 Score = 28.9 bits (63), Expect = 5.8 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -2 Query: 281 MAHQRS*SNGCTISLVDSTEAXXTPKVCQQNGVLPCPFSLVNSTAXPHIYSNHVQ 117 M +QRS G + ++ A T + + G+ P LV++ H+YSNHV+ Sbjct: 419 MLYQRSCDMGLGVPFNIASYALLTILIAKATGLRPG--ELVHTLGDAHVYSNHVE 471
>DRTS_TRYBB (Q27783) Bifunctional dihydrofolate reductase-thymidylate synthase| (DHFR-TS) [Includes: Dihydrofolate reductase (EC 1.5.1.3); Thymidylate synthase (EC 2.1.1.45)] Length = 527 Score = 28.9 bits (63), Expect = 5.8 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = -2 Query: 281 MAHQRS*SNGCTISLVDSTEAXXTPKVCQQNGVLPCPFSLVNSTAXPHIYSNHVQ--KMQ 108 M +QRS G + ++ A T + + +G+ P LV++ H+YSNHV+ + Q Sbjct: 425 MLYQRSCDMGLGVPFNIASYALLTFLMAKASGLRPG--ELVHTLGDAHVYSNHVEPCRKQ 482 Query: 107 LK 102 LK Sbjct: 483 LK 484
>USH2A_HUMAN (O75445) Usherin precursor (Usher syndrome type-2A protein) (Usher| syndrome type IIa protein) Length = 5202 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 248 CTHCSRIAGEPYQGLSSSSEPTGEWYTPSKLI 343 CT + EP+ G + + P G W TP +I Sbjct: 3661 CTSAGCTSSEPFLGQTLQAAPEGVWVTPRHII 3692
>TYSY_BRAJA (Q89G35) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase)| Length = 264 Score = 28.1 bits (61), Expect = 9.9 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -2 Query: 221 AXXTPKVCQQNGVLPCPFSLVNSTAXPHIYSNHVQKMQLK 102 A T V Q G+ P F V+S H+YSNH+++ +L+ Sbjct: 182 ALLTMMVAQVTGLKPGDF--VHSFGDTHLYSNHLEQAKLQ 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,924,842 Number of Sequences: 219361 Number of extensions: 995442 Number of successful extensions: 2105 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2105 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)