Clone Name | rbaak4k22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YLIF_ECOLI (P75801) Hypothetical membrane protein yliF | 30 | 4.4 | 2 | YLIF_ECO57 (Q8X6V3) Hypothetical membrane protein yliF | 30 | 4.4 | 3 | MRCKG_HUMAN (Q6DT37) Serine/threonine-protein kinase MRCK gamma ... | 29 | 7.6 |
---|
>YLIF_ECOLI (P75801) Hypothetical membrane protein yliF| Length = 442 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = -1 Query: 423 AALDAHLSALRCRCQPKRVRER--ISRDLVLGAHFCSVLHGGVDYFLLDVALLNTVLN 256 AAL A +S C +RV R + ++ ++ HF VL GG+ + DV L ++ N Sbjct: 236 AALVAVISGASCLYLVRRVINRGIVEKEAIINNHFERVLDGGLFFSAADVKKLYSMYN 293
>YLIF_ECO57 (Q8X6V3) Hypothetical membrane protein yliF| Length = 442 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = -1 Query: 423 AALDAHLSALRCRCQPKRVRER--ISRDLVLGAHFCSVLHGGVDYFLLDVALLNTVLN 256 AAL A +S C +RV R + ++ ++ HF VL GG+ + DV L ++ N Sbjct: 236 AALVAVISGASCLYLVRRVINRGIVEKEAIINNHFERVLDGGLFFSAADVKKLYSMYN 293
>MRCKG_HUMAN (Q6DT37) Serine/threonine-protein kinase MRCK gamma (EC 2.7.11.1)| (CDC42-binding protein kinase gamma) (Myotonic dystrophy kinase-related CDC42-binding kinase gamma) (Myotonic dystrophy protein kinase-like alpha) (MRCK gamma) (DMPK-like gamma Length = 1551 Score = 28.9 bits (63), Expect = 7.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 445 CSSLSYYCSTRCPPQCSQVPLP 380 C + Y+C T C PQ P+P Sbjct: 909 CDACGYFCHTTCAPQAPPCPVP 930 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,763,776 Number of Sequences: 219361 Number of extensions: 1212169 Number of successful extensions: 3154 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3149 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)