| Clone Name | rbaak4k12 |
|---|---|
| Clone Library Name | barley_pub |
>RINI_PANTR (Q8HZP9) Ribonuclease inhibitor (Ribonuclease/angiogenin inhibitor| 1) Length = 460 Score = 28.5 bits (62), Expect = 4.8 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 135 LPQDSNCLGDXXXXXXV*RVDE-GDLLEALKVYDTCWS 245 L +NCLGD V V + G LLE L +YD WS Sbjct: 402 LDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDIYWS 439
>RINI_HUMAN (P13489) Ribonuclease inhibitor (Ribonuclease/angiogenin inhibitor| 1) (RAI) (Placental ribonuclease inhibitor) (RNase inhibitor) (RI) Length = 460 Score = 28.5 bits (62), Expect = 4.8 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 135 LPQDSNCLGDXXXXXXV*RVDE-GDLLEALKVYDTCWS 245 L +NCLGD V V + G LLE L +YD WS Sbjct: 402 LDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDIYWS 439
>SMP1_MAGPO (Q9Y778) Subtilisin-like proteinase Mp1 precursor (EC 3.4.21.-)| Length = 404 Score = 28.5 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 47 SFHQHLRWTGKSHRRH*QKEQS 112 SFH HL W G HRR K + Sbjct: 46 SFHNHLSWVGDVHRRSVSKRDT 67
>GEF1_SCHPO (Q09763) Rho guanine nucleotide exchange factor gef1| Length = 753 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = -1 Query: 236 GIIYLESLQKVTLIYSSHCSSCAGVTETVAVLRKEAAS 123 G+I+LESL ++ IY+ +C+ V + + R++ A+ Sbjct: 398 GLIFLESLSEIGQIYTGYCNRQDSVFKIITKWREKPAT 435
>SPAG1_MOUSE (Q80ZX8) Sperm-associated antigen 1 (Infertility-related sperm| protein Spag-1) (TPR-containing protein involved in spermatogenesis) (TPIS) Length = 901 Score = 28.1 bits (61), Expect = 6.2 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -3 Query: 174 LCWCHRDSCCLEEGSCQPC*SDCS 103 + + +R +C L+EG+C+ C DC+ Sbjct: 473 ILYSNRAACYLKEGNCRDCIQDCN 496
>RBN_IDILO (Q5QV33) tRNA-processing ribonuclease BN (EC 3.1.-.-) (RNase BN)| Length = 284 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 34 LVVVIFPSTLEMDGKISSSPLTERTIRLAWLAASFLKTATVSVTPAQLEQCE 189 L + FP+ + G +++ P+ I L+WL TVS+ QL+Q E Sbjct: 229 LYITFFPTYQAIYGALATIPILIVWIYLSWLIVLIGAVLTVSLEEYQLQQPE 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,185,461 Number of Sequences: 219361 Number of extensions: 572472 Number of successful extensions: 1698 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1696 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)