| Clone Name | rbaak4j21 |
|---|---|
| Clone Library Name | barley_pub |
>POTE1_MOUSE (Q91WC1) Protection of telomeres 1 (mPot1) (POT1-like telomere| end-binding protein) Length = 640 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 160 IYRGGCLGCKTLQKNPRRNLQARFQKMPWT 249 ++ GC C +L+ P +NL +RF K PWT Sbjct: 504 VHHYGCKQCSSLK--PIQNLNSRFHKGPWT 531
>LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1| protein) Length = 350 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = -2 Query: 258 WKLCPRHLLETSLQIPSRILLQSLAT*ATTPVNWFADARLQGPALLNCCFLVQDS 94 W L R L E + P +LL +L T + A ARL P CC +D+ Sbjct: 42 WGLARRGLAEHAHLAPPELLLLALGALGWTALRSAATARLFRPLAKRCCLQPRDA 96
>YBXB_BACSU (P37872) Hypothetical protein ybxB (P23) (ORF23)| Length = 201 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 58 VQNKKYNYTAKPGILYKKAAVQQGRALQPSVSEPIYRGGCL--GC 186 ++NK + +T+ G+ KK R L S EP GG L GC Sbjct: 23 LRNKDFTFTSDSGVFSKKEVDFGSRLLIDSFEEPEVEGGILDVGC 67
>CARB_ASHGO (Q75D66) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1113 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -1 Query: 328 ILESDLLRPRSF*STNVTKGCNFVEALSKASSGNELADSVEDSSAESCN 182 I+E ++ RSF + G NFVE KA G +L D A S N Sbjct: 857 IIECNIRASRSFPFVSKVLGVNFVEIAVKAFLGGDLVPPSCDLMARSYN 905
>SYR_LACPL (Q88X53) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 562 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +3 Query: 243 LDRASTKLQPLVTLVLQKDRGLRRSLSSIAXKNAFPPISFDHFGDW 380 +D +S + +++ + + SL++I K + P+ +H GDW Sbjct: 116 IDMSSPNIAKPISMGHLRSTVIGNSLANILSKLDYQPVKINHLGDW 161
>COBT_BRUSU (Q8G155) Nicotinate-nucleotide--dimethylbenzimidazole| phosphoribosyltransferase (EC 2.4.2.21) (NN:DBI PRT) (N(1)-alpha-phosphoribosyltransferase) Length = 339 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 106 KKAAVQQGRAL-QPSVSEPIYRGGCLGCKTLQKNPRRNLQARFQKMP 243 K AAV+Q AL QP + +P+ CLG + + L AR +K+P Sbjct: 202 KLAAVRQAVALHQPHLQDPLEVLRCLGGREIAAMAGAILAARMEKIP 248
>SDK1_CHICK (Q8AV58) Protein sidekick-1 precursor| Length = 2169 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 291 EALTSPKAAILWKLCPRHLLETSLQIPSRILLQS 190 E +PK AI WK + L S+QIP +LL+S Sbjct: 454 EVSGAPKPAISWKKGNQILASGSVQIPRFVLLES 487
>SYR_STRP8 (Q8NZ22) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 563 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 240 ALDRASTKLQPLVTLVLQKDRGLRRSLSSIAXKNAFPPISFDHFGDW 380 A+D +S + ++ + + SL+ I K + P+ +H GDW Sbjct: 115 AIDMSSPNIAKPFSIGHLRSTVIGDSLAHIFAKMGYQPVKINHLGDW 161
>SYR_STRP6 (Q5X9F1) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 563 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 240 ALDRASTKLQPLVTLVLQKDRGLRRSLSSIAXKNAFPPISFDHFGDW 380 A+D +S + ++ + + SL+ I K + P+ +H GDW Sbjct: 115 AIDMSSPNIAKPFSIGHLRSTVIGDSLAHIFAKMGYKPVKINHLGDW 161
>SYR_STRP3 (Q8K5J2) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 563 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 240 ALDRASTKLQPLVTLVLQKDRGLRRSLSSIAXKNAFPPISFDHFGDW 380 A+D +S + ++ + + SL+ I K + P+ +H GDW Sbjct: 115 AIDMSSPNIAKPFSIGHLRSTVIGDSLAHIFAKMGYKPVKINHLGDW 161
>SYR_STRP1 (Q99XL5) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 563 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 240 ALDRASTKLQPLVTLVLQKDRGLRRSLSSIAXKNAFPPISFDHFGDW 380 A+D +S + ++ + + SL+ I K + P+ +H GDW Sbjct: 115 AIDMSSPNIAKPFSIGHLRSTVIGDSLAHIFAKMGYKPVKINHLGDW 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,403,018 Number of Sequences: 219361 Number of extensions: 1013583 Number of successful extensions: 2410 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2410 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)