Clone Name | rbaak4j10 |
---|---|
Clone Library Name | barley_pub |
>IAA30_ORYSA (P0C132) Auxin-responsive protein IAA30 (Indoleacetic acid-induced| protein 30) Length = 277 Score = 61.6 bits (148), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS Sbjct: 249 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277
>IAA16_ARATH (O24407) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 236 Score = 58.5 bits (140), Expect = 1e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 +SCKR+RIMKGSEAIGLAPRA+EKCKNRS Sbjct: 208 DSCKRIRIMKGSEAIGLAPRALEKCKNRS 236
>IAA14_ARATH (Q38832) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) (SOLITARY-ROOT protein) Length = 228 Score = 57.4 bits (137), Expect = 2e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 ESCKRLRIMKGSEAIGLAPRAMEK KNRS Sbjct: 200 ESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228
>IAA7_ARATH (Q38825) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) (Auxin resistant 2) Length = 243 Score = 56.6 bits (135), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEK-CKNRS 425 ESCKRLRIMKGSEA+GLAPRAMEK CKNRS Sbjct: 214 ESCKRLRIMKGSEAVGLAPRAMEKYCKNRS 243
>IAA11_ORYSA (Q75GK0) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 233 Score = 54.7 bits (130), Expect = 1e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKN 431 ESCKRLRIMKGSEAIGLAPRA+EKCK+ Sbjct: 207 ESCKRLRIMKGSEAIGLAPRAVEKCKS 233
>IAA17_ARATH (P93830) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) (Auxin response 3) Length = 229 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 ++CKRLR+MKGS+AIGLAPRAMEKCK+R+ Sbjct: 201 DTCKRLRLMKGSDAIGLAPRAMEKCKSRA 229
>AUX28_SOYBN (P13089) Auxin-induced protein AUX28| Length = 243 Score = 52.8 bits (125), Expect = 6e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 511 ESCKRLRIMKGSEAI--GLAPRAMEKCKNRS 425 ESCKRLRIMKG EAI GLAPRAM KCKNRS Sbjct: 213 ESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS 243
>IAA13_ORYSA (Q7Y1Y5) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 236 Score = 52.8 bits (125), Expect = 6e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 ESCKRLRIMKGSEAIGLAPRA +K KN+S Sbjct: 208 ESCKRLRIMKGSEAIGLAPRAKDKYKNKS 236
>IAA27_ARATH (Q9ZSY8) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) (Auxin-induced protein 27) (Phytochrome-associated protein 2) Length = 305 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 SCK+LRIMK SEAIGLAPR MEKC++R+ Sbjct: 278 SCKKLRIMKSSEAIGLAPRVMEKCRSRN 305
>IAA3_ORYSA (Q5NB25) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) Length = 263 Score = 50.1 bits (118), Expect = 4e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 +SC+RLRIMKGS+AIGLAPRA EK KNR+ Sbjct: 235 DSCRRLRIMKGSDAIGLAPRAGEKSKNRN 263
>IAA17_ORYSA (Q75GB1) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) Length = 257 Score = 49.7 bits (117), Expect = 5e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 SC+RLRIMKGS+AIGLAPRA++K KNR+ Sbjct: 230 SCRRLRIMKGSDAIGLAPRAVDKSKNRN 257
>IAA21_ORYSA (Q5Z749) Auxin-responsive protein IAA21 (Indoleacetic acid-induced| protein 21) Length = 266 Score = 49.3 bits (116), Expect = 6e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNRS 425 +SC+RLRIMKGS+A+GLAPRA +K KNR+ Sbjct: 238 DSCRRLRIMKGSDAVGLAPRATDKSKNRN 266
>IAA8_ARATH (Q38826) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 321 Score = 43.5 bits (101), Expect = 3e-04 Identities = 18/28 (64%), Positives = 26/28 (92%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAMEKCKNR 428 E+C++L+IMKGS++IGLAP A+EK KN+ Sbjct: 291 ETCQKLKIMKGSDSIGLAPGAVEKSKNK 318
>IAA9_ARATH (Q38827) Auxin-responsive protein IAA9 (Indoleacetic acid-induced| protein 9) Length = 338 Score = 39.7 bits (91), Expect = 0.005 Identities = 20/29 (68%), Positives = 24/29 (82%), Gaps = 2/29 (6%) Frame = -3 Query: 505 CKRLRIMKGSEAIGL--APRAMEKCKNRS 425 CK+L+IMKG +AIGL APRAMEK K R+ Sbjct: 310 CKKLKIMKGCDAIGLAAAPRAMEKSKMRA 338
>IAA19_ORYSA (Q6AT33) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) Length = 281 Score = 37.4 bits (85), Expect = 0.024 Identities = 14/23 (60%), Positives = 22/23 (95%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGLAPRAMEK 440 SC++LRIM+GS+A G+APR++E+ Sbjct: 254 SCRKLRIMRGSDAAGMAPRSLEQ 276
>IAA1_ORYSA (Q5VRD1) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 199 Score = 36.6 bits (83), Expect = 0.041 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRAME 443 E+C+RLR+MK SEA+ LAPRA + Sbjct: 177 ETCQRLRLMKSSEAVNLAPRAAQ 199
>IAA23_ORYSA (Q69VE0) Auxin-responsive protein IAA23 (Indoleacetic acid-induced| protein 23) Length = 193 Score = 35.4 bits (80), Expect = 0.092 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPR 452 ESCKR+R+MK SEA+ L+PR Sbjct: 170 ESCKRIRLMKSSEAVNLSPR 189
>IAA15_ORYSA (Q6AT10) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 212 Score = 35.0 bits (79), Expect = 0.12 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGLAPRA 449 E+C+RLR+MK SEA+ LAPR+ Sbjct: 191 ETCQRLRLMKSSEAVNLAPRS 211
>IAA5_ORYSA (Q59AF3) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) Length = 271 Score = 34.3 bits (77), Expect = 0.20 Identities = 12/22 (54%), Positives = 21/22 (95%) Frame = -3 Query: 505 CKRLRIMKGSEAIGLAPRAMEK 440 C++L+IM+GS+A G+APR++E+ Sbjct: 245 CRKLKIMRGSDAAGIAPRSIEQ 266
>AX22D_PHAAU (O24542) Auxin-induced protein 22D (Indole-3-acetic acid-induced| protein ARG13) Length = 193 Score = 32.3 bits (72), Expect = 0.78 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 SCKRLRIMKGSEA GL Sbjct: 175 SCKRLRIMKGSEAKGL 190
>AX22B_PHAAU (P32294) Auxin-induced protein 22B (Indole-3-acetic acid-induced| protein ARG4) Length = 196 Score = 32.3 bits (72), Expect = 0.78 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 SCKRLRIMKGSEA GL Sbjct: 177 SCKRLRIMKGSEARGL 192
>IAA19_ARATH (O24409) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) (MASSUGU2 protein) Length = 197 Score = 32.0 bits (71), Expect = 1.0 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = -3 Query: 511 ESCKRLRIMKGSEA--IGLAPRAMEK 440 ESCKRLRIMK S+A GL PR +++ Sbjct: 172 ESCKRLRIMKRSDATGFGLQPRGVDE 197
>IAA4_PEA (P49679) Auxin-induced protein IAA4| Length = 189 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 SCKRLRIMKG+EA GL Sbjct: 170 SCKRLRIMKGTEAKGL 185
>IAA3_ARATH (Q38822) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) (Short hypocotyl) (Suppressor of HY2) Length = 189 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 +CKRLRIMKGSEA GL Sbjct: 170 TCKRLRIMKGSEAKGL 185
>IAA31_ORYSA (P0C133) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 197 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 +CKRLRIMKGSEA GL Sbjct: 177 TCKRLRIMKGSEARGL 192
>IAA12_ARATH (Q38830) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) (BODENLOS protein) Length = 239 Score = 31.2 bits (69), Expect = 1.7 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGLAPRAMEK 440 S KRLRIM SEA GLAPR E+ Sbjct: 208 SVKRLRIMGTSEASGLAPRRQEQ 230
>AX22E_PHAAU (O24543) Auxin-induced protein 22E (Indole-3-acetic acid-induced| protein ARG14) Length = 203 Score = 30.8 bits (68), Expect = 2.3 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 SCKRLRI+KGSEA GL Sbjct: 185 SCKRLRIIKGSEAKGL 200
>IAA4_ARATH (P33077) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) (Auxin-induced protein AUX2-11) Length = 186 Score = 30.8 bits (68), Expect = 2.3 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 SCKRLRIMKGSE GL Sbjct: 166 SCKRLRIMKGSEVKGL 181
>IAA12_ORYSA (Q75GK1) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) Length = 226 Score = 30.0 bits (66), Expect = 3.9 Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL-APRAME 443 +CK+LRIMK SEA GL +PR M+ Sbjct: 203 TCKKLRIMKRSEATGLGSPRQMK 225
>IAA15_ARATH (Q9C966) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 179 Score = 29.6 bits (65), Expect = 5.0 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 511 ESCKRLRIMKGSEAIGL 461 ESCKR+R+MK +AIGL Sbjct: 163 ESCKRMRLMKTGDAIGL 179
>AUX22_SOYBN (P13088) Auxin-induced protein AUX22| Length = 195 Score = 29.6 bits (65), Expect = 5.0 Identities = 16/26 (61%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 511 ESCKRLRIMKGSEA--IGLAPRAMEK 440 ESCKRLRIMK S+A GL P+ K Sbjct: 162 ESCKRLRIMKKSDAKGFGLQPKGSLK 187
>IAA13_ARATH (Q38831) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 247 Score = 29.3 bits (64), Expect = 6.6 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGLAPRAME 443 S KRLR+MK SEA GLA R E Sbjct: 216 SVKRLRVMKTSEANGLAARNQE 237
>IAA2_ARATH (P49678) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 174 Score = 28.9 bits (63), Expect = 8.6 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 508 SCKRLRIMKGSEAIGL 461 SCKRLRIMKGS+A L Sbjct: 155 SCKRLRIMKGSDAPAL 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,881,265 Number of Sequences: 219361 Number of extensions: 930773 Number of successful extensions: 1830 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1828 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)